BLASTX nr result
ID: Forsythia21_contig00006033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00006033 (239 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009351843.1| PREDICTED: E3 ubiquitin-protein ligase synov... 57 5e-06 >ref|XP_009351843.1| PREDICTED: E3 ubiquitin-protein ligase synoviolin-like [Pyrus x bretschneideri] gi|694321365|ref|XP_009351844.1| PREDICTED: E3 ubiquitin-protein ligase synoviolin-like [Pyrus x bretschneideri] Length = 544 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/56 (46%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -1 Query: 179 IPGGNVQYGAGLGT--NYSATQMDEQRKFIEHQIEFLQNQLKLLQTSDAKRTVESG 18 +PG NV YG L + N +A++++ Q+KF++HQIE LQNQL++LQ K +V+ G Sbjct: 458 VPGANVAYGGRLSSDPNLTASELEAQKKFLQHQIEILQNQLQVLQKPKPKESVDMG 513