BLASTX nr result
ID: Forsythia21_contig00006020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00006020 (368 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007141445.1| hypothetical protein PHAVU_008G196200g [Phas... 65 2e-08 ref|XP_010054008.1| PREDICTED: probable transcription factor KAN... 64 5e-08 emb|CDP17439.1| unnamed protein product [Coffea canephora] 64 5e-08 gb|KCW89774.1| hypothetical protein EUGRSUZ_A02031 [Eucalyptus g... 64 5e-08 ref|XP_006575636.1| PREDICTED: putative Myb family transcription... 64 5e-08 gb|KHN11994.1| Putative Myb family transcription factor [Glycine... 62 1e-07 emb|CDP17437.1| unnamed protein product [Coffea canephora] 60 6e-07 ref|XP_010272285.1| PREDICTED: putative Myb family transcription... 58 2e-06 ref|XP_010272283.1| PREDICTED: putative Myb family transcription... 58 2e-06 ref|XP_011032774.1| PREDICTED: uncharacterized protein LOC105131... 58 3e-06 emb|CDP17438.1| unnamed protein product [Coffea canephora] 58 3e-06 gb|KDO40898.1| hypothetical protein CISIN_1g038544mg [Citrus sin... 58 3e-06 ref|XP_002306755.1| hypothetical protein POPTR_0005s22750g [Popu... 58 3e-06 ref|XP_006485154.1| PREDICTED: uncharacterized protein LOC102621... 58 3e-06 ref|XP_006437113.1| hypothetical protein CICLE_v10033825mg, part... 58 3e-06 ref|XP_002530207.1| hypothetical protein RCOM_0324560 [Ricinus c... 57 4e-06 >ref|XP_007141445.1| hypothetical protein PHAVU_008G196200g [Phaseolus vulgaris] gi|561014578|gb|ESW13439.1| hypothetical protein PHAVU_008G196200g [Phaseolus vulgaris] Length = 200 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -2 Query: 316 TPKKKIECWRNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 T KK C R+ VR+Y+KSELP L+WTP+LHQHFVQA+Q +GGKH Sbjct: 6 TQKKMKNCERS-VRQYNKSELPRLRWTPQLHQHFVQAIQSIGGKH 49 >ref|XP_010054008.1| PREDICTED: probable transcription factor KAN4 [Eucalyptus grandis] Length = 216 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -2 Query: 328 VITSTPKKKIECWRNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKHN 179 ++TS + RN VR+Y+KSE+P L+WTPELH HF++AV+ LGGK+N Sbjct: 6 IMTSPGAETKRSRRNEVRRYNKSEVPRLRWTPELHNHFIEAVEQLGGKYN 55 >emb|CDP17439.1| unnamed protein product [Coffea canephora] Length = 101 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 295 CWRNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 C R VRKY KS P L+WTPELH+HF++AV+HLGGKH Sbjct: 4 CNRTGVRKYKKSAFPRLRWTPELHEHFIEAVEHLGGKH 41 >gb|KCW89774.1| hypothetical protein EUGRSUZ_A02031 [Eucalyptus grandis] Length = 212 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -2 Query: 328 VITSTPKKKIECWRNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKHN 179 ++TS + RN VR+Y+KSE+P L+WTPELH HF++AV+ LGGK+N Sbjct: 2 IMTSPGAETKRSRRNEVRRYNKSEVPRLRWTPELHNHFIEAVEQLGGKYN 51 >ref|XP_006575636.1| PREDICTED: putative Myb family transcription factor At1g14600-like [Glycine max] Length = 213 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 289 RNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 R+ VRKY+KSELP L+WTPELHQHFV+A+Q LGG H Sbjct: 6 RSSVRKYNKSELPRLRWTPELHQHFVEAIQSLGGSH 41 >gb|KHN11994.1| Putative Myb family transcription factor [Glycine soja] Length = 187 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 280 VRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 VRKY+KSELP L+WTPELHQHFV+A++ LGGKH Sbjct: 9 VRKYNKSELPRLRWTPELHQHFVEAIESLGGKH 41 >emb|CDP17437.1| unnamed protein product [Coffea canephora] Length = 68 Score = 60.1 bits (144), Expect = 6e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 295 CWRNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGK 185 C + +RKY KS P L+WTPELH+HFV+AV+HLGGK Sbjct: 4 CIKTGIRKYKKSSFPRLRWTPELHEHFVEAVEHLGGK 40 >ref|XP_010272285.1| PREDICTED: putative Myb family transcription factor At1g14600 isoform X2 [Nelumbo nucifera] Length = 249 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 280 VRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 VR YSKS++P L+WTPELHQ FV AV HLGGKH Sbjct: 9 VRHYSKSDVPRLRWTPELHQRFVSAVDHLGGKH 41 >ref|XP_010272283.1| PREDICTED: putative Myb family transcription factor At1g14600 isoform X1 [Nelumbo nucifera] gi|720052044|ref|XP_010272284.1| PREDICTED: putative Myb family transcription factor At1g14600 isoform X1 [Nelumbo nucifera] Length = 250 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 280 VRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 VR YSKS++P L+WTPELHQ FV AV HLGGKH Sbjct: 9 VRHYSKSDVPRLRWTPELHQRFVSAVDHLGGKH 41 >ref|XP_011032774.1| PREDICTED: uncharacterized protein LOC105131474 [Populus euphratica] Length = 230 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -2 Query: 289 RNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 +N VR+Y+KSE P L+WTPELH+HFV+AV+ LGGK+ Sbjct: 6 KNGVRQYNKSEHPRLRWTPELHEHFVEAVERLGGKY 41 >emb|CDP17438.1| unnamed protein product [Coffea canephora] Length = 101 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -2 Query: 295 CWRNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 C + VR+Y KS P L+WTPELH+HFV+AV+ LGGKH Sbjct: 4 CNKTGVRQYKKSACPRLRWTPELHEHFVEAVEQLGGKH 41 >gb|KDO40898.1| hypothetical protein CISIN_1g038544mg [Citrus sinensis] Length = 69 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 289 RNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 R VR+Y+KSELP L+WTPELH+HF QAV+ LGGK+ Sbjct: 6 RTGVRQYNKSELPRLRWTPELHKHFSQAVERLGGKY 41 >ref|XP_002306755.1| hypothetical protein POPTR_0005s22750g [Populus trichocarpa] gi|222856204|gb|EEE93751.1| hypothetical protein POPTR_0005s22750g [Populus trichocarpa] Length = 68 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -2 Query: 289 RNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 +N VR+Y+KSE P L+WTPELH+HFV+AV+ LGGK+ Sbjct: 6 KNGVRQYNKSEHPRLRWTPELHEHFVEAVERLGGKY 41 >ref|XP_006485154.1| PREDICTED: uncharacterized protein LOC102621802 [Citrus sinensis] Length = 235 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 289 RNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 R VR+Y+KSELP L+WTPELH+HF QAV+ LGGK+ Sbjct: 6 RTGVRQYNKSELPRLRWTPELHKHFSQAVERLGGKY 41 >ref|XP_006437113.1| hypothetical protein CICLE_v10033825mg, partial [Citrus clementina] gi|557539309|gb|ESR50353.1| hypothetical protein CICLE_v10033825mg, partial [Citrus clementina] Length = 122 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 289 RNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 R VR+Y+KSELP L+WTPELH+HF QAV+ LGGK+ Sbjct: 6 RTGVRQYNKSELPRLRWTPELHKHFSQAVERLGGKY 41 >ref|XP_002530207.1| hypothetical protein RCOM_0324560 [Ricinus communis] gi|223530283|gb|EEF32181.1| hypothetical protein RCOM_0324560 [Ricinus communis] Length = 68 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -2 Query: 289 RNRVRKYSKSELP*LQWTPELHQHFVQAVQHLGGKH 182 RN +R+Y+KS+LP L+WTPELHQ FV+AV+ LGGK+ Sbjct: 6 RNGIRQYNKSQLPRLRWTPELHQDFVKAVEELGGKY 41