BLASTX nr result
ID: Forsythia21_contig00004137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00004137 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091164.1| PREDICTED: calcium-transporting ATPase 12, p... 63 7e-08 >ref|XP_011091164.1| PREDICTED: calcium-transporting ATPase 12, plasma membrane-type-like, partial [Sesamum indicum] Length = 596 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -3 Query: 139 KFQDNMHCTDPVFNLPNHFVISVLNKKRWHLAVAKINCSRVLLSLF 2 K Q N++C D V ++P+ V SV NKKRWHLA+A +NCSR LLSLF Sbjct: 4 KLQANLNCMDIVLDIPDDLVSSVRNKKRWHLALASVNCSRALLSLF 49