BLASTX nr result
ID: Forsythia21_contig00002948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00002948 (343 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828929.1| PREDICTED: dihydrolipoyllysine-residue acety... 59 2e-06 >ref|XP_012828929.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial [Erythranthe guttatus] gi|604347716|gb|EYU45871.1| hypothetical protein MIMGU_mgv1a003906mg [Erythranthe guttata] Length = 556 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/58 (51%), Positives = 36/58 (62%), Gaps = 13/58 (22%) Frame = -2 Query: 138 MTFSSRIFHHSRKLRHTHKVLQNDRAILVRWVAN----------DV---SQYGLGSGG 4 MT+++RIFHHS+KLRHTH V Q D AI VRW N D+ SQ+G G GG Sbjct: 1 MTYAARIFHHSKKLRHTHYVTQKDHAIFVRWFTNYARPSADKLDDISRSSQHGFGPGG 58