BLASTX nr result
ID: Forsythia21_contig00002916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00002916 (415 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007680099.1| hypothetical protein BAUCODRAFT_125737 [Baud... 57 6e-06 >ref|XP_007680099.1| hypothetical protein BAUCODRAFT_125737 [Baudoinia compniacensis UAMH 10762] gi|449296742|gb|EMC92761.1| hypothetical protein BAUCODRAFT_125737 [Baudoinia compniacensis UAMH 10762] Length = 88 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 5/57 (8%) Frame = -2 Query: 360 MPRNGDGSSDNVVDNSAGDQVHGVGED-----SSVDRSNKAAPAPTLEKGEALPGMD 205 MPR+G G+ DN V+ D VHG GE+ S VDRS+KAAP P +EKG++L G++ Sbjct: 1 MPRDGSGAGDNAVEQGQ-DLVHGAGENDAPSSSGVDRSSKAAPPPEVEKGDSLEGLN 56