BLASTX nr result
ID: Forsythia21_contig00002750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00002750 (916 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN48296.1| hypothetical protein glysoja_007965 [Glycine soja] 59 5e-06 gb|KHN39080.1| hypothetical protein glysoja_017374 [Glycine soja] 59 5e-06 >gb|KHN48296.1| hypothetical protein glysoja_007965 [Glycine soja] Length = 53 Score = 58.9 bits (141), Expect = 5e-06 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = +2 Query: 83 MAKSIRNLNSSWMEVAPAPFIFPHKPSTIPKLETIDEERSE 205 MAK IRNL SSWMEVAPAP IFP KPS P LETI EE +E Sbjct: 1 MAKGIRNL-SSWMEVAPAPIIFPTKPSNSPALETITEEVAE 40 >gb|KHN39080.1| hypothetical protein glysoja_017374 [Glycine soja] Length = 51 Score = 58.9 bits (141), Expect = 5e-06 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = +2 Query: 83 MAKSIRNLNSSWMEVAPAPFIFPHKPSTIPKLETIDEERSE 205 MAK IRNL SSWMEVAPAP IFP KPS P LETI EE +E Sbjct: 1 MAKGIRNL-SSWMEVAPAPIIFPTKPSNSPALETITEEVAE 40