BLASTX nr result
ID: Forsythia21_contig00002601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00002601 (226 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069859.1| PREDICTED: probable alpha,alpha-trehalose-ph... 64 5e-08 emb|CDP02920.1| unnamed protein product [Coffea canephora] 60 4e-07 ref|XP_012831326.1| PREDICTED: probable alpha,alpha-trehalose-ph... 59 1e-06 >ref|XP_011069859.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 [Sesamum indicum] Length = 860 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -1 Query: 226 MAKYYLDDTVEVIKMLQGLSAASAHQLLKSPHNQVSFEGS 107 MAKYYLDDTVEVI+MLQGLSAAS Q K P N VSFEGS Sbjct: 820 MAKYYLDDTVEVIRMLQGLSAASGQQQPKQPQNLVSFEGS 859 >emb|CDP02920.1| unnamed protein product [Coffea canephora] Length = 867 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 226 MAKYYLDDTVEVIKMLQGLSAASAHQLLKSPHNQVSFE 113 MAKYYLDDT EVIKMLQG+S ASAH L K H+QVSFE Sbjct: 827 MAKYYLDDTSEVIKMLQGVSVASAHLLPKPSHHQVSFE 864 >ref|XP_012831326.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 [Erythranthe guttatus] gi|604343575|gb|EYU42464.1| hypothetical protein MIMGU_mgv1a001200mg [Erythranthe guttata] Length = 867 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -1 Query: 226 MAKYYLDDTVEVIKMLQGLSAASA--HQLLKSPHNQVSFEGS 107 MAKYYLDDT EVIKMLQG+S+AS+ H + K P N+VSFEGS Sbjct: 825 MAKYYLDDTFEVIKMLQGISSASSAQHLIPKEPRNRVSFEGS 866