BLASTX nr result
ID: Forsythia21_contig00002512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00002512 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090682.1| PREDICTED: 40S ribosomal protein S3a [Sesamu... 62 2e-07 ref|XP_011073454.1| PREDICTED: 40S ribosomal protein S3a-like [S... 62 2e-07 gb|EPS71864.1| hypothetical protein M569_02887, partial [Genlise... 62 2e-07 gb|EPS65103.1| hypothetical protein M569_09676, partial [Genlise... 62 2e-07 ref|XP_012845805.1| PREDICTED: 40S ribosomal protein S3a-like [E... 61 3e-07 ref|XP_012832411.1| PREDICTED: 40S ribosomal protein S3a [Erythr... 61 3e-07 gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythra... 61 3e-07 dbj|BAC10914.1| putative 40S ribosomal protein S3A [Zinnia elegans] 61 3e-07 gb|EPQ14173.1| 40S ribosomal protein S3a [Myotis brandtii] 60 4e-07 ref|XP_010259119.1| PREDICTED: 40S ribosomal protein S3a-1 [Nelu... 60 6e-07 ref|XP_010256142.1| PREDICTED: 40S ribosomal protein S3a-1-like ... 60 6e-07 ref|XP_012089233.1| PREDICTED: 40S ribosomal protein S3a-1 [Jatr... 60 6e-07 dbj|BAJ93929.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 6e-07 sp|P49198.2|RS3A_HELAN RecName: Full=40S ribosomal protein S3a [... 60 8e-07 ref|XP_012457052.1| PREDICTED: 40S ribosomal protein S3a-like [G... 60 8e-07 gb|KHG05975.1| 40S ribosomal S3a [Gossypium arboreum] gi|7288482... 60 8e-07 ref|XP_007034836.1| Ribosomal protein S3Ae isoform 2 [Theobroma ... 60 8e-07 ref|XP_007034835.1| Ribosomal protein S3Ae isoform 1 [Theobroma ... 60 8e-07 ref|XP_012633752.1| PREDICTED: 40S ribosomal protein S3a-like [M... 59 1e-06 ref|XP_012853972.1| PREDICTED: 40S ribosomal protein S3a-like [E... 59 1e-06 >ref|XP_011090682.1| PREDICTED: 40S ribosomal protein S3a [Sesamum indicum] Length = 260 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPS+FNTRNVGKTLVTRTQGTK+ Sbjct: 28 DWYDIKAPSVFNTRNVGKTLVTRTQGTKI 56 >ref|XP_011073454.1| PREDICTED: 40S ribosomal protein S3a-like [Sesamum indicum] Length = 260 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPS+FNTRNVGKTLVTRTQGTK+ Sbjct: 28 DWYDIKAPSVFNTRNVGKTLVTRTQGTKI 56 >gb|EPS71864.1| hypothetical protein M569_02887, partial [Genlisea aurea] Length = 266 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYD+KAPS+FNTRNVGKTLVTRTQGTK+ Sbjct: 34 DWYDVKAPSIFNTRNVGKTLVTRTQGTKI 62 >gb|EPS65103.1| hypothetical protein M569_09676, partial [Genlisea aurea] Length = 165 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYD+KAPS+FNTRN+GKTLVTRTQGTK+ Sbjct: 30 DWYDVKAPSIFNTRNIGKTLVTRTQGTKI 58 >ref|XP_012845805.1| PREDICTED: 40S ribosomal protein S3a-like [Erythranthe guttatus] Length = 253 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYD+KAPS+FNTRN+GKTLVTRTQGTK+ Sbjct: 28 DWYDVKAPSVFNTRNIGKTLVTRTQGTKI 56 >ref|XP_012832411.1| PREDICTED: 40S ribosomal protein S3a [Erythranthe guttatus] Length = 260 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYD+KAPS+FNTRN+GKTLVTRTQGTK+ Sbjct: 28 DWYDVKAPSVFNTRNIGKTLVTRTQGTKI 56 >gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythranthe guttata] Length = 648 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYD+KAPS+FNTRN+GKTLVTRTQGTK+ Sbjct: 416 DWYDVKAPSVFNTRNIGKTLVTRTQGTKI 444 >dbj|BAC10914.1| putative 40S ribosomal protein S3A [Zinnia elegans] Length = 66 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPSLF+TRNVGKTLVTRTQGTK+ Sbjct: 28 DWYDIKAPSLFSTRNVGKTLVTRTQGTKI 56 >gb|EPQ14173.1| 40S ribosomal protein S3a [Myotis brandtii] Length = 68 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKLIMM 5 DWYD+KAP+LFN RN+GKTLVTRTQGTK+ +M Sbjct: 29 DWYDVKAPALFNIRNIGKTLVTRTQGTKIHLM 60 >ref|XP_010259119.1| PREDICTED: 40S ribosomal protein S3a-1 [Nelumbo nucifera] Length = 261 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPS+F TRNVGKTLVTRTQGTK+ Sbjct: 28 DWYDIKAPSIFTTRNVGKTLVTRTQGTKI 56 >ref|XP_010256142.1| PREDICTED: 40S ribosomal protein S3a-1-like [Nelumbo nucifera] Length = 261 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPS+F TRNVGKTLVTRTQGTK+ Sbjct: 28 DWYDIKAPSIFTTRNVGKTLVTRTQGTKI 56 >ref|XP_012089233.1| PREDICTED: 40S ribosomal protein S3a-1 [Jatropha curcas] gi|643708727|gb|KDP23643.1| hypothetical protein JCGZ_23476 [Jatropha curcas] Length = 263 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPS+FN RNVGKTLVTRTQGTK+ Sbjct: 28 DWYDIKAPSVFNVRNVGKTLVTRTQGTKI 56 >dbj|BAJ93929.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 262 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAP+LFNTRN+GKTLV+RTQGTK+ Sbjct: 28 DWYDIKAPTLFNTRNIGKTLVSRTQGTKI 56 >sp|P49198.2|RS3A_HELAN RecName: Full=40S ribosomal protein S3a [Helianthus annuus] gi|469248|gb|AAA80978.1| ribosomal protein S3a [Helianthus annuus] Length = 260 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPSLF TRNVGKTLVTRTQGTK+ Sbjct: 28 DWYDIKAPSLFITRNVGKTLVTRTQGTKI 56 >ref|XP_012457052.1| PREDICTED: 40S ribosomal protein S3a-like [Gossypium raimondii] gi|763805323|gb|KJB72261.1| hypothetical protein B456_011G167500 [Gossypium raimondii] Length = 262 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPS+F TRNVGKTLVTRTQGTK+ Sbjct: 28 DWYDIKAPSVFTTRNVGKTLVTRTQGTKI 56 >gb|KHG05975.1| 40S ribosomal S3a [Gossypium arboreum] gi|728848282|gb|KHG27725.1| 40S ribosomal S3a [Gossypium arboreum] Length = 262 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPS+F TRNVGKTLVTRTQGTK+ Sbjct: 28 DWYDIKAPSVFTTRNVGKTLVTRTQGTKI 56 >ref|XP_007034836.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao] gi|508713865|gb|EOY05762.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao] Length = 246 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPS+F TRNVGKTLVTRTQGTK+ Sbjct: 12 DWYDIKAPSVFTTRNVGKTLVTRTQGTKI 40 >ref|XP_007034835.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao] gi|508713864|gb|EOY05761.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao] Length = 262 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYDIKAPS+F TRNVGKTLVTRTQGTK+ Sbjct: 28 DWYDIKAPSVFTTRNVGKTLVTRTQGTKI 56 >ref|XP_012633752.1| PREDICTED: 40S ribosomal protein S3a-like [Microcebus murinus] Length = 264 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKLI 11 DWYD+KAP++FN RN+GKTLVTRTQGTK++ Sbjct: 29 DWYDVKAPAMFNIRNIGKTLVTRTQGTKIV 58 >ref|XP_012853972.1| PREDICTED: 40S ribosomal protein S3a-like [Erythranthe guttatus] gi|604304354|gb|EYU23687.1| hypothetical protein MIMGU_mgv1a012196mg [Erythranthe guttata] Length = 259 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -3 Query: 100 DWYDIKAPSLFNTRNVGKTLVTRTQGTKL 14 DWYD+KAPS+F+TRN+GKTLVTRTQGTK+ Sbjct: 28 DWYDVKAPSVFSTRNIGKTLVTRTQGTKI 56