BLASTX nr result
ID: Forsythia21_contig00002488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00002488 (502 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04335.1| unnamed protein product [Coffea canephora] 72 1e-10 ref|XP_007009672.1| Pseudo response regulator, putative isoform ... 67 4e-09 ref|XP_007009671.1| Pseudo response regulator, putative isoform ... 67 4e-09 ref|XP_007009670.1| Pseudo response regulator, putative isoform ... 67 4e-09 ref|XP_007009668.1| Pseudo response regulator, putative isoform ... 67 4e-09 ref|XP_007009667.1| Pseudo response regulator, putative isoform ... 67 4e-09 ref|XP_007009666.1| Pseudo response regulator isoform 3 [Theobro... 67 4e-09 ref|XP_007009665.1| Pseudo response regulator, putative isoform ... 67 4e-09 ref|XP_007009664.1| Pseudo response regulator, putative isoform ... 67 4e-09 ref|XP_010658154.1| PREDICTED: two-component response regulator-... 66 8e-09 ref|XP_010658157.1| PREDICTED: two-component response regulator-... 66 8e-09 emb|CAN64552.1| hypothetical protein VITISV_007888 [Vitis vinifera] 66 8e-09 ref|XP_012082256.1| PREDICTED: two-component response regulator-... 65 2e-08 ref|XP_011466635.1| PREDICTED: two-component response regulator-... 63 9e-08 ref|XP_010253458.1| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_011094752.1| PREDICTED: two-component response regulator-... 62 2e-07 ref|XP_008447246.1| PREDICTED: two-component response regulator-... 61 3e-07 ref|XP_008369955.1| PREDICTED: two-component response regulator-... 61 3e-07 ref|XP_007027203.1| Pseudo-response regulator 7, putative isofor... 61 3e-07 ref|XP_007027202.1| Sensory transduction histidine kinase, putat... 61 3e-07 >emb|CDP04335.1| unnamed protein product [Coffea canephora] Length = 794 Score = 72.0 bits (175), Expect = 1e-10 Identities = 41/68 (60%), Positives = 43/68 (63%), Gaps = 13/68 (19%) Frame = -1 Query: 502 QNGSSGHR-------------ESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKF 362 QNGSSG SDN A KCGAG G GSRS VDQ+RLSQREA+L KF Sbjct: 684 QNGSSGQNGSSTAVIVEGTNVASDNGATGKCGAGGGIASGSRSCVDQDRLSQREAALYKF 743 Query: 361 RQKRKERC 338 RQKRKERC Sbjct: 744 RQKRKERC 751 >ref|XP_007009672.1| Pseudo response regulator, putative isoform 9, partial [Theobroma cacao] gi|508726585|gb|EOY18482.1| Pseudo response regulator, putative isoform 9, partial [Theobroma cacao] Length = 769 Score = 67.4 bits (163), Expect = 4e-09 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -1 Query: 502 QNGSSG-------HRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 344 QNGSS + ES+N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 677 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 736 Query: 343 RC 338 RC Sbjct: 737 RC 738 >ref|XP_007009671.1| Pseudo response regulator, putative isoform 8, partial [Theobroma cacao] gi|508726584|gb|EOY18481.1| Pseudo response regulator, putative isoform 8, partial [Theobroma cacao] Length = 708 Score = 67.4 bits (163), Expect = 4e-09 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -1 Query: 502 QNGSSG-------HRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 344 QNGSS + ES+N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 616 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 675 Query: 343 RC 338 RC Sbjct: 676 RC 677 >ref|XP_007009670.1| Pseudo response regulator, putative isoform 7, partial [Theobroma cacao] gi|508726583|gb|EOY18480.1| Pseudo response regulator, putative isoform 7, partial [Theobroma cacao] Length = 709 Score = 67.4 bits (163), Expect = 4e-09 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -1 Query: 502 QNGSSG-------HRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 344 QNGSS + ES+N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 617 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 676 Query: 343 RC 338 RC Sbjct: 677 RC 678 >ref|XP_007009668.1| Pseudo response regulator, putative isoform 5 [Theobroma cacao] gi|508726581|gb|EOY18478.1| Pseudo response regulator, putative isoform 5 [Theobroma cacao] Length = 781 Score = 67.4 bits (163), Expect = 4e-09 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -1 Query: 502 QNGSSG-------HRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 344 QNGSS + ES+N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 632 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 691 Query: 343 RC 338 RC Sbjct: 692 RC 693 >ref|XP_007009667.1| Pseudo response regulator, putative isoform 4 [Theobroma cacao] gi|508726580|gb|EOY18477.1| Pseudo response regulator, putative isoform 4 [Theobroma cacao] Length = 732 Score = 67.4 bits (163), Expect = 4e-09 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -1 Query: 502 QNGSSG-------HRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 344 QNGSS + ES+N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 633 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 692 Query: 343 RC 338 RC Sbjct: 693 RC 694 >ref|XP_007009666.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|590564476|ref|XP_007009669.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|508726579|gb|EOY18476.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|508726582|gb|EOY18479.1| Pseudo response regulator isoform 3 [Theobroma cacao] Length = 792 Score = 67.4 bits (163), Expect = 4e-09 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -1 Query: 502 QNGSSG-------HRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 344 QNGSS + ES+N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 693 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 752 Query: 343 RC 338 RC Sbjct: 753 RC 754 >ref|XP_007009665.1| Pseudo response regulator, putative isoform 2 [Theobroma cacao] gi|508726578|gb|EOY18475.1| Pseudo response regulator, putative isoform 2 [Theobroma cacao] Length = 782 Score = 67.4 bits (163), Expect = 4e-09 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -1 Query: 502 QNGSSG-------HRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 344 QNGSS + ES+N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 633 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 692 Query: 343 RC 338 RC Sbjct: 693 RC 694 >ref|XP_007009664.1| Pseudo response regulator, putative isoform 1 [Theobroma cacao] gi|508726577|gb|EOY18474.1| Pseudo response regulator, putative isoform 1 [Theobroma cacao] Length = 799 Score = 67.4 bits (163), Expect = 4e-09 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 7/62 (11%) Frame = -1 Query: 502 QNGSSG-------HRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 344 QNGSS + ES+N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 693 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 752 Query: 343 RC 338 RC Sbjct: 753 RC 754 >ref|XP_010658154.1| PREDICTED: two-component response regulator-like PRR37 isoform X1 [Vitis vinifera] gi|731411847|ref|XP_010658155.1| PREDICTED: two-component response regulator-like PRR37 isoform X1 [Vitis vinifera] gi|731411849|ref|XP_010658156.1| PREDICTED: two-component response regulator-like PRR37 isoform X1 [Vitis vinifera] Length = 770 Score = 66.2 bits (160), Expect = 8e-09 Identities = 35/56 (62%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -1 Query: 499 NGSSGHRESDNKAIAKCGAG--EGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 338 N + ESD+ K GAG GSG GSRS VDQN+ +QREA+LNKFRQKRKERC Sbjct: 676 NAQGTNMESDDGIAGKGGAGGGSGSGSGSRSGVDQNQYAQREAALNKFRQKRKERC 731 >ref|XP_010658157.1| PREDICTED: two-component response regulator-like PRR37 isoform X2 [Vitis vinifera] gi|297736458|emb|CBI25329.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 66.2 bits (160), Expect = 8e-09 Identities = 35/56 (62%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -1 Query: 499 NGSSGHRESDNKAIAKCGAG--EGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 338 N + ESD+ K GAG GSG GSRS VDQN+ +QREA+LNKFRQKRKERC Sbjct: 675 NAQGTNMESDDGIAGKGGAGGGSGSGSGSRSGVDQNQYAQREAALNKFRQKRKERC 730 >emb|CAN64552.1| hypothetical protein VITISV_007888 [Vitis vinifera] Length = 519 Score = 66.2 bits (160), Expect = 8e-09 Identities = 35/56 (62%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -1 Query: 499 NGSSGHRESDNKAIAKCGAG--EGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 338 N + ESD+ K GAG GSG GSRS VDQN+ +QREA+LNKFRQKRKERC Sbjct: 397 NAQGTNMESDDGIAGKGGAGGGSGSGSGSRSGVDQNQYAQREAALNKFRQKRKERC 452 >ref|XP_012082256.1| PREDICTED: two-component response regulator-like APRR7 [Jatropha curcas] gi|643717614|gb|KDP29057.1| hypothetical protein JCGZ_16446 [Jatropha curcas] Length = 786 Score = 65.1 bits (157), Expect = 2e-08 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 9/64 (14%) Frame = -1 Query: 502 QNGSSG-------HRESDNKAIAKCGAGEGSGCGSR--SEVDQNRLSQREASLNKFRQKR 350 QNGSS + ESDN K G+G+GSG GS + +DQN+ SQREA+L KFRQKR Sbjct: 684 QNGSSTAVNAGGTNMESDNGIAGKTGSGDGSGSGSGGGNRIDQNKFSQREAALTKFRQKR 743 Query: 349 KERC 338 KERC Sbjct: 744 KERC 747 >ref|XP_011466635.1| PREDICTED: two-component response regulator-like APRR7 [Fragaria vesca subsp. vesca] Length = 765 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = -1 Query: 502 QNGSS---GHRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 338 QNGS+ + ESDN K G+G+GSG S + VD+N+ S+REA+L KFRQKR ERC Sbjct: 669 QNGSNIGGTNMESDNGVAGKSGSGDGSGNQSGNRVDENKFSRREAALTKFRQKRNERC 726 >ref|XP_010253458.1| PREDICTED: two-component response regulator-like PRR37 [Nelumbo nucifera] Length = 787 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/62 (54%), Positives = 41/62 (66%), Gaps = 7/62 (11%) Frame = -1 Query: 502 QNGSSG-------HRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 344 QNGSS + E+DN+ K GAG+ G G+ S VDQNR +QR A+L KFRQKRKE Sbjct: 687 QNGSSTAVNTCVMNVENDNRVSGKKGAGDSVGSGTGSGVDQNRFAQRVAALTKFRQKRKE 746 Query: 343 RC 338 RC Sbjct: 747 RC 748 >ref|XP_011094752.1| PREDICTED: two-component response regulator-like APRR3 [Sesamum indicum] Length = 706 Score = 62.0 bits (149), Expect = 2e-07 Identities = 34/62 (54%), Positives = 43/62 (69%), Gaps = 7/62 (11%) Frame = -1 Query: 502 QNGSS-------GHRESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 344 QNGSS + ESD + K G+G+ SG GS + VD+N+L+QREA+L KFRQKRKE Sbjct: 607 QNGSSTAVNAVGNNAESDGQG-GKSGSGDASGSGSGNRVDENKLAQREAALIKFRQKRKE 665 Query: 343 RC 338 RC Sbjct: 666 RC 667 >ref|XP_008447246.1| PREDICTED: two-component response regulator-like APRR7 [Cucumis melo] gi|659068907|ref|XP_008447255.1| PREDICTED: two-component response regulator-like APRR7 [Cucumis melo] gi|659068909|ref|XP_008447263.1| PREDICTED: two-component response regulator-like APRR7 [Cucumis melo] Length = 791 Score = 61.2 bits (147), Expect = 3e-07 Identities = 35/67 (52%), Positives = 44/67 (65%), Gaps = 12/67 (17%) Frame = -1 Query: 502 QNGSSG-------HRESDNKA-----IAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFR 359 QNGSS + ESDN + G+G GSG GS +++DQN++SQREA+L KFR Sbjct: 686 QNGSSTAVNAGGLNMESDNGVGRSGDASGSGSGSGSGSGSGNKMDQNKVSQREAALTKFR 745 Query: 358 QKRKERC 338 QKRKERC Sbjct: 746 QKRKERC 752 >ref|XP_008369955.1| PREDICTED: two-component response regulator-like APRR7 [Malus domestica] Length = 573 Score = 60.8 bits (146), Expect = 3e-07 Identities = 32/59 (54%), Positives = 37/59 (62%), Gaps = 6/59 (10%) Frame = -1 Query: 496 GSSGHR------ESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 338 GS GH ESD K G+G+GSG S + VD+N QREA+L KFRQKRKERC Sbjct: 476 GSGGHNVGGTKLESDYGVAGKSGSGDGSGNQSGNRVDENMFKQREAALTKFRQKRKERC 534 >ref|XP_007027203.1| Pseudo-response regulator 7, putative isoform 7, partial [Theobroma cacao] gi|508715808|gb|EOY07705.1| Pseudo-response regulator 7, putative isoform 7, partial [Theobroma cacao] Length = 562 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 478 ESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 338 ESDN K G+G+ SG GS S VDQ++ + REA+L KFRQKRKERC Sbjct: 485 ESDNGIAGKSGSGDASGSGSGSGVDQSKSAHREAALTKFRQKRKERC 531 >ref|XP_007027202.1| Sensory transduction histidine kinase, putative isoform 6 [Theobroma cacao] gi|508715807|gb|EOY07704.1| Sensory transduction histidine kinase, putative isoform 6 [Theobroma cacao] Length = 606 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 478 ESDNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 338 ESDN K G+G+ SG GS S VDQ++ + REA+L KFRQKRKERC Sbjct: 529 ESDNGIAGKSGSGDASGSGSGSGVDQSKSAHREAALTKFRQKRKERC 575