BLASTX nr result
ID: Forsythia21_contig00002487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00002487 (543 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04335.1| unnamed protein product [Coffea canephora] 70 7e-10 ref|XP_007009672.1| Pseudo response regulator, putative isoform ... 65 1e-08 ref|XP_007009671.1| Pseudo response regulator, putative isoform ... 65 1e-08 ref|XP_007009670.1| Pseudo response regulator, putative isoform ... 65 1e-08 ref|XP_007009668.1| Pseudo response regulator, putative isoform ... 65 1e-08 ref|XP_007009667.1| Pseudo response regulator, putative isoform ... 65 1e-08 ref|XP_007009666.1| Pseudo response regulator isoform 3 [Theobro... 65 1e-08 ref|XP_007009665.1| Pseudo response regulator, putative isoform ... 65 1e-08 ref|XP_007009664.1| Pseudo response regulator, putative isoform ... 65 1e-08 ref|XP_010658154.1| PREDICTED: two-component response regulator-... 64 4e-08 ref|XP_010658157.1| PREDICTED: two-component response regulator-... 64 4e-08 emb|CAN64552.1| hypothetical protein VITISV_007888 [Vitis vinifera] 64 4e-08 ref|XP_004142221.2| PREDICTED: two-component response regulator-... 62 1e-07 ref|XP_012082256.1| PREDICTED: two-component response regulator-... 62 2e-07 ref|XP_008369955.1| PREDICTED: two-component response regulator-... 62 2e-07 ref|XP_011094752.1| PREDICTED: two-component response regulator-... 61 3e-07 ref|XP_009338559.1| PREDICTED: two-component response regulator-... 61 3e-07 ref|XP_009338556.1| PREDICTED: two-component response regulator-... 61 3e-07 ref|XP_009333615.1| PREDICTED: two-component response regulator-... 61 3e-07 ref|XP_009333613.1| PREDICTED: two-component response regulator-... 61 3e-07 >emb|CDP04335.1| unnamed protein product [Coffea canephora] Length = 794 Score = 69.7 bits (169), Expect = 7e-10 Identities = 40/68 (58%), Positives = 43/68 (63%), Gaps = 13/68 (19%) Frame = -1 Query: 543 QNGSSGHHESG-------------NKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKF 403 QNGSSG + S N A KCGAG G GSRS VDQ+RLSQREA+L KF Sbjct: 684 QNGSSGQNGSSTAVIVEGTNVASDNGATGKCGAGGGIASGSRSCVDQDRLSQREAALYKF 743 Query: 402 RQKRKERC 379 RQKRKERC Sbjct: 744 RQKRKERC 751 >ref|XP_007009672.1| Pseudo response regulator, putative isoform 9, partial [Theobroma cacao] gi|508726585|gb|EOY18482.1| Pseudo response regulator, putative isoform 9, partial [Theobroma cacao] Length = 769 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 7/62 (11%) Frame = -1 Query: 543 QNGSSG-------HHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 385 QNGSS + ES N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 677 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 736 Query: 384 RC 379 RC Sbjct: 737 RC 738 >ref|XP_007009671.1| Pseudo response regulator, putative isoform 8, partial [Theobroma cacao] gi|508726584|gb|EOY18481.1| Pseudo response regulator, putative isoform 8, partial [Theobroma cacao] Length = 708 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 7/62 (11%) Frame = -1 Query: 543 QNGSSG-------HHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 385 QNGSS + ES N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 616 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 675 Query: 384 RC 379 RC Sbjct: 676 RC 677 >ref|XP_007009670.1| Pseudo response regulator, putative isoform 7, partial [Theobroma cacao] gi|508726583|gb|EOY18480.1| Pseudo response regulator, putative isoform 7, partial [Theobroma cacao] Length = 709 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 7/62 (11%) Frame = -1 Query: 543 QNGSSG-------HHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 385 QNGSS + ES N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 617 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 676 Query: 384 RC 379 RC Sbjct: 677 RC 678 >ref|XP_007009668.1| Pseudo response regulator, putative isoform 5 [Theobroma cacao] gi|508726581|gb|EOY18478.1| Pseudo response regulator, putative isoform 5 [Theobroma cacao] Length = 781 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 7/62 (11%) Frame = -1 Query: 543 QNGSSG-------HHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 385 QNGSS + ES N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 632 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 691 Query: 384 RC 379 RC Sbjct: 692 RC 693 >ref|XP_007009667.1| Pseudo response regulator, putative isoform 4 [Theobroma cacao] gi|508726580|gb|EOY18477.1| Pseudo response regulator, putative isoform 4 [Theobroma cacao] Length = 732 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 7/62 (11%) Frame = -1 Query: 543 QNGSSG-------HHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 385 QNGSS + ES N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 633 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 692 Query: 384 RC 379 RC Sbjct: 693 RC 694 >ref|XP_007009666.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|590564476|ref|XP_007009669.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|508726579|gb|EOY18476.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|508726582|gb|EOY18479.1| Pseudo response regulator isoform 3 [Theobroma cacao] Length = 792 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 7/62 (11%) Frame = -1 Query: 543 QNGSSG-------HHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 385 QNGSS + ES N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 693 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 752 Query: 384 RC 379 RC Sbjct: 753 RC 754 >ref|XP_007009665.1| Pseudo response regulator, putative isoform 2 [Theobroma cacao] gi|508726578|gb|EOY18475.1| Pseudo response regulator, putative isoform 2 [Theobroma cacao] Length = 782 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 7/62 (11%) Frame = -1 Query: 543 QNGSSG-------HHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 385 QNGSS + ES N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 633 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 692 Query: 384 RC 379 RC Sbjct: 693 RC 694 >ref|XP_007009664.1| Pseudo response regulator, putative isoform 1 [Theobroma cacao] gi|508726577|gb|EOY18474.1| Pseudo response regulator, putative isoform 1 [Theobroma cacao] Length = 799 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 7/62 (11%) Frame = -1 Query: 543 QNGSSG-------HHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 385 QNGSS + ES N K GAG G G G R+ VDQNR +QREA+LNKFRQKRKE Sbjct: 693 QNGSSTVLNTRGMNLESENGVPGKGGAGGGIGSGGRNVVDQNRFAQREAALNKFRQKRKE 752 Query: 384 RC 379 RC Sbjct: 753 RC 754 >ref|XP_010658154.1| PREDICTED: two-component response regulator-like PRR37 isoform X1 [Vitis vinifera] gi|731411847|ref|XP_010658155.1| PREDICTED: two-component response regulator-like PRR37 isoform X1 [Vitis vinifera] gi|731411849|ref|XP_010658156.1| PREDICTED: two-component response regulator-like PRR37 isoform X1 [Vitis vinifera] Length = 770 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -1 Query: 537 GSSGHHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 379 G++ + G G G GSG GSRS VDQN+ +QREA+LNKFRQKRKERC Sbjct: 679 GTNMESDDGIAGKGGAGGGSGSGSGSRSGVDQNQYAQREAALNKFRQKRKERC 731 >ref|XP_010658157.1| PREDICTED: two-component response regulator-like PRR37 isoform X2 [Vitis vinifera] gi|297736458|emb|CBI25329.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -1 Query: 537 GSSGHHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 379 G++ + G G G GSG GSRS VDQN+ +QREA+LNKFRQKRKERC Sbjct: 678 GTNMESDDGIAGKGGAGGGSGSGSGSRSGVDQNQYAQREAALNKFRQKRKERC 730 >emb|CAN64552.1| hypothetical protein VITISV_007888 [Vitis vinifera] Length = 519 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -1 Query: 537 GSSGHHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 379 G++ + G G G GSG GSRS VDQN+ +QREA+LNKFRQKRKERC Sbjct: 400 GTNMESDDGIAGKGGAGGGSGSGSGSRSGVDQNQYAQREAALNKFRQKRKERC 452 >ref|XP_004142221.2| PREDICTED: two-component response regulator-like APRR7 [Cucumis sativus] gi|778693266|ref|XP_011653603.1| PREDICTED: two-component response regulator-like APRR7 [Cucumis sativus] gi|778693269|ref|XP_011653604.1| PREDICTED: two-component response regulator-like APRR7 [Cucumis sativus] gi|778693272|ref|XP_011653605.1| PREDICTED: two-component response regulator-like APRR7 [Cucumis sativus] gi|700199037|gb|KGN54195.1| hypothetical protein Csa_4G293050 [Cucumis sativus] Length = 794 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/51 (56%), Positives = 40/51 (78%) Frame = -1 Query: 531 SGHHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 379 +G SG+ + + G+G GSG GS +++DQN++SQREA+L KFRQKRKERC Sbjct: 705 NGVGRSGDASGSGSGSGSGSGSGSGNQMDQNKVSQREAALTKFRQKRKERC 755 >ref|XP_012082256.1| PREDICTED: two-component response regulator-like APRR7 [Jatropha curcas] gi|643717614|gb|KDP29057.1| hypothetical protein JCGZ_16446 [Jatropha curcas] Length = 786 Score = 62.0 bits (149), Expect = 2e-07 Identities = 35/64 (54%), Positives = 42/64 (65%), Gaps = 9/64 (14%) Frame = -1 Query: 543 QNGSSG-------HHESGNKAIAKCGAGEGSGCGSR--SEVDQNRLSQREASLNKFRQKR 391 QNGSS + ES N K G+G+GSG GS + +DQN+ SQREA+L KFRQKR Sbjct: 684 QNGSSTAVNAGGTNMESDNGIAGKTGSGDGSGSGSGGGNRIDQNKFSQREAALTKFRQKR 743 Query: 390 KERC 379 KERC Sbjct: 744 KERC 747 >ref|XP_008369955.1| PREDICTED: two-component response regulator-like APRR7 [Malus domestica] Length = 573 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/62 (51%), Positives = 38/62 (61%), Gaps = 7/62 (11%) Frame = -1 Query: 543 QNGSSGHHESGNKAI-------AKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKE 385 QNG SG H G + K G+G+GSG S + VD+N QREA+L KFRQKRKE Sbjct: 473 QNGGSGGHNVGGTKLESDYGVAGKSGSGDGSGNQSGNRVDENMFKQREAALTKFRQKRKE 532 Query: 384 RC 379 RC Sbjct: 533 RC 534 >ref|XP_011094752.1| PREDICTED: two-component response regulator-like APRR3 [Sesamum indicum] Length = 706 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/61 (52%), Positives = 42/61 (68%), Gaps = 6/61 (9%) Frame = -1 Query: 543 QNGSS------GHHESGNKAIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKER 382 QNGSS G++ + K G+G+ SG GS + VD+N+L+QREA+L KFRQKRKER Sbjct: 607 QNGSSTAVNAVGNNAESDGQGGKSGSGDASGSGSGNRVDENKLAQREAALIKFRQKRKER 666 Query: 381 C 379 C Sbjct: 667 C 667 >ref|XP_009338559.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Pyrus x bretschneideri] Length = 746 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 6/59 (10%) Frame = -1 Query: 537 GSSGHHESGNK------AIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 379 GS GH+ G K K G+G+GSG S + VD+N+ QREA+L KFRQKRKERC Sbjct: 651 GSGGHNVGGTKLECDYGVAGKSGSGDGSGNQSGNGVDENKFKQREAALTKFRQKRKERC 709 >ref|XP_009338556.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Pyrus x bretschneideri] gi|694421405|ref|XP_009338557.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Pyrus x bretschneideri] gi|694421407|ref|XP_009338558.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Pyrus x bretschneideri] Length = 772 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 6/59 (10%) Frame = -1 Query: 537 GSSGHHESGNK------AIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 379 GS GH+ G K K G+G+GSG S + VD+N+ QREA+L KFRQKRKERC Sbjct: 677 GSGGHNVGGTKLECDYGVAGKSGSGDGSGNQSGNGVDENKFKQREAALTKFRQKRKERC 735 >ref|XP_009333615.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Pyrus x bretschneideri] Length = 746 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 6/59 (10%) Frame = -1 Query: 537 GSSGHHESGNK------AIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 379 GS GH+ G K K G+G+GSG S + VD+N+ QREA+L KFRQKRKERC Sbjct: 651 GSGGHNVGGTKLECDYGVAGKSGSGDGSGNQSGNGVDENKFKQREAALTKFRQKRKERC 709 >ref|XP_009333613.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Pyrus x bretschneideri] Length = 772 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 6/59 (10%) Frame = -1 Query: 537 GSSGHHESGNK------AIAKCGAGEGSGCGSRSEVDQNRLSQREASLNKFRQKRKERC 379 GS GH+ G K K G+G+GSG S + VD+N+ QREA+L KFRQKRKERC Sbjct: 677 GSGGHNVGGTKLECDYGVAGKSGSGDGSGNQSGNGVDENKFKQREAALTKFRQKRKERC 735