BLASTX nr result
ID: Forsythia21_contig00002422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00002422 (347 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012839562.1| PREDICTED: somatic embryogenesis receptor ki... 76 1e-11 gb|ADO51751.1| leucine rich repeat protein [Camellia sinensis] 76 1e-11 gb|ACN94266.1| leucine-rich repeat protein [Solenostemon scutell... 76 1e-11 ref|XP_010251701.1| PREDICTED: somatic embryogenesis receptor ki... 75 2e-11 ref|XP_009399943.1| PREDICTED: somatic embryogenesis receptor ki... 74 3e-11 emb|CDP20902.1| unnamed protein product [Coffea canephora] 74 3e-11 ref|XP_002275877.1| PREDICTED: somatic embryogenesis receptor ki... 74 3e-11 ref|XP_011003857.1| PREDICTED: somatic embryogenesis receptor ki... 73 6e-11 ref|XP_010904696.1| PREDICTED: somatic embryogenesis receptor ki... 73 6e-11 ref|XP_002530200.1| serine-threonine protein kinase, plant-type,... 73 6e-11 ref|XP_006470435.1| PREDICTED: somatic embryogenesis receptor ki... 73 6e-11 ref|XP_006446386.1| hypothetical protein CICLE_v10016555mg [Citr... 73 6e-11 ref|XP_002314247.1| hypothetical protein POPTR_0009s02400g [Popu... 73 6e-11 gb|AAP23944.1| leucine-rich repeat protein [Citrus x microcarpa] 73 6e-11 ref|XP_011079162.1| PREDICTED: somatic embryogenesis receptor ki... 73 8e-11 emb|CBI32849.3| unnamed protein product [Vitis vinifera] 73 8e-11 ref|XP_002283683.1| PREDICTED: somatic embryogenesis receptor ki... 73 8e-11 ref|XP_009419841.1| PREDICTED: somatic embryogenesis receptor ki... 72 1e-10 ref|XP_011070023.1| PREDICTED: somatic embryogenesis receptor ki... 72 1e-10 ref|XP_009414221.1| PREDICTED: somatic embryogenesis receptor ki... 72 1e-10 >ref|XP_012839562.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Erythranthe guttatus] gi|604330681|gb|EYU35664.1| hypothetical protein MIMGU_mgv1a013556mg [Erythranthe guttata] Length = 217 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS Sbjct: 185 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 217 >gb|ADO51751.1| leucine rich repeat protein [Camellia sinensis] Length = 254 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS Sbjct: 222 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 254 >gb|ACN94266.1| leucine-rich repeat protein [Solenostemon scutellarioides] Length = 218 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS Sbjct: 186 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 218 >ref|XP_010251701.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Nelumbo nucifera] Length = 219 Score = 74.7 bits (182), Expect = 2e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPELQGLA+YDTNCS Sbjct: 187 GPFEHIPLNNFENNPRLEGPELQGLATYDTNCS 219 >ref|XP_009399943.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Musa acuminata subsp. malaccensis] Length = 218 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNC 250 GPFEHIPLNNFENNPRLEGPELQGLASYDTNC Sbjct: 187 GPFEHIPLNNFENNPRLEGPELQGLASYDTNC 218 >emb|CDP20902.1| unnamed protein product [Coffea canephora] Length = 220 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPELQGLASY+TNCS Sbjct: 188 GPFEHIPLNNFENNPRLEGPELQGLASYETNCS 220 >ref|XP_002275877.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Vitis vinifera] gi|296083993|emb|CBI24381.3| unnamed protein product [Vitis vinifera] Length = 214 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNC 250 GPFEHIPLNNFENNPRLEGPELQGLASYDTNC Sbjct: 183 GPFEHIPLNNFENNPRLEGPELQGLASYDTNC 214 >ref|XP_011003857.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Populus euphratica] Length = 215 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPEL GLASYDTNCS Sbjct: 183 GPFEHIPLNNFENNPRLEGPELLGLASYDTNCS 215 >ref|XP_010904696.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Elaeis guineensis] Length = 217 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNC 250 GPFEHIPLNNFENNPRLEGPELQGLA+YDTNC Sbjct: 186 GPFEHIPLNNFENNPRLEGPELQGLATYDTNC 217 >ref|XP_002530200.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223530293|gb|EEF32190.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 223 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPEL GLASYDTNCS Sbjct: 191 GPFEHIPLNNFENNPRLEGPELLGLASYDTNCS 223 >ref|XP_006470435.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Citrus sinensis] Length = 231 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPEL GLASYDTNCS Sbjct: 199 GPFEHIPLNNFENNPRLEGPELLGLASYDTNCS 231 >ref|XP_006446386.1| hypothetical protein CICLE_v10016555mg [Citrus clementina] gi|557548997|gb|ESR59626.1| hypothetical protein CICLE_v10016555mg [Citrus clementina] Length = 228 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPEL GLASYDTNCS Sbjct: 196 GPFEHIPLNNFENNPRLEGPELLGLASYDTNCS 228 >ref|XP_002314247.1| hypothetical protein POPTR_0009s02400g [Populus trichocarpa] gi|118487907|gb|ABK95775.1| unknown [Populus trichocarpa] gi|222850655|gb|EEE88202.1| hypothetical protein POPTR_0009s02400g [Populus trichocarpa] Length = 215 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPEL GLASYDTNCS Sbjct: 183 GPFEHIPLNNFENNPRLEGPELLGLASYDTNCS 215 >gb|AAP23944.1| leucine-rich repeat protein [Citrus x microcarpa] Length = 228 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHIPLNNFENNPRLEGPEL GLASYDTNCS Sbjct: 196 GPFEHIPLNNFENNPRLEGPELLGLASYDTNCS 228 >ref|XP_011079162.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Sesamum indicum] Length = 214 Score = 72.8 bits (177), Expect = 8e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 G FEHIPLNNFENNPRLEGPELQGLASYDTNCS Sbjct: 182 GSFEHIPLNNFENNPRLEGPELQGLASYDTNCS 214 >emb|CBI32849.3| unnamed protein product [Vitis vinifera] Length = 302 Score = 72.8 bits (177), Expect = 8e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHI LNNFENNPRLEGPELQGLASYDTNCS Sbjct: 270 GPFEHIQLNNFENNPRLEGPELQGLASYDTNCS 302 >ref|XP_002283683.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Vitis vinifera] Length = 218 Score = 72.8 bits (177), Expect = 8e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNCS 247 GPFEHI LNNFENNPRLEGPELQGLASYDTNCS Sbjct: 186 GPFEHIQLNNFENNPRLEGPELQGLASYDTNCS 218 >ref|XP_009419841.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Musa acuminata subsp. malaccensis] Length = 218 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNC 250 GPFEHIPLNNFENNPRLEGPELQGLA YDTNC Sbjct: 187 GPFEHIPLNNFENNPRLEGPELQGLAMYDTNC 218 >ref|XP_011070023.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Sesamum indicum] Length = 217 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNC 250 GPFEHIPLNNFENNPRLEGPELQGLA YDTNC Sbjct: 185 GPFEHIPLNNFENNPRLEGPELQGLAIYDTNC 216 >ref|XP_009414221.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Musa acuminata subsp. malaccensis] Length = 218 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 345 GPFEHIPLNNFENNPRLEGPELQGLASYDTNC 250 GPFEHIPLNNFENNPRLEGPELQGLA YDTNC Sbjct: 187 GPFEHIPLNNFENNPRLEGPELQGLALYDTNC 218