BLASTX nr result
ID: Forsythia21_contig00002393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00002393 (747 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847406.1| PREDICTED: SNARE-interacting protein KEULE-l... 79 3e-12 ref|XP_012846369.1| PREDICTED: SNARE-interacting protein KEULE-l... 79 3e-12 gb|EYU28980.1| hypothetical protein MIMGU_mgv1a0251092mg, partia... 79 3e-12 ref|XP_010934674.1| PREDICTED: SNARE-interacting protein KEULE-l... 78 6e-12 ref|XP_008791331.1| PREDICTED: SNARE-interacting protein KEULE [... 78 6e-12 ref|XP_012574806.1| PREDICTED: protein transport Sec1a-like isof... 77 1e-11 gb|KHN40152.1| Putative ATP-dependent RNA helicase kurz [Glycine... 77 1e-11 gb|KHM98888.1| Protein transport Sec1a [Glycine soja] 77 1e-11 ref|XP_010053400.1| PREDICTED: SNARE-interacting protein KEULE [... 77 1e-11 gb|KCW77685.1| hypothetical protein EUGRSUZ_D01986 [Eucalyptus g... 77 1e-11 ref|XP_006574263.1| PREDICTED: protein transport Sec1a-like [Gly... 77 1e-11 ref|XP_004513139.1| PREDICTED: protein transport Sec1a-like isof... 77 1e-11 ref|XP_004513137.1| PREDICTED: protein transport Sec1a-like isof... 77 1e-11 ref|XP_004506504.1| PREDICTED: protein transport Sec1a-like [Cic... 77 1e-11 ref|XP_003521950.1| PREDICTED: protein transport Sec1a-like [Gly... 77 1e-11 emb|CDP09881.1| unnamed protein product [Coffea canephora] 76 2e-11 ref|XP_011069844.1| PREDICTED: SNARE-interacting protein KEULE-l... 76 2e-11 ref|XP_011069837.1| PREDICTED: SNARE-interacting protein KEULE-l... 76 2e-11 ref|XP_011069828.1| PREDICTED: SNARE-interacting protein KEULE-l... 76 2e-11 ref|XP_009764743.1| PREDICTED: SNARE-interacting protein KEULE i... 76 2e-11 >ref|XP_012847406.1| PREDICTED: SNARE-interacting protein KEULE-like [Erythranthe guttatus] Length = 638 Score = 79.0 bits (193), Expect = 3e-12 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +3 Query: 627 RDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 RDG ELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK Sbjct: 321 RDGGELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 360 >ref|XP_012846369.1| PREDICTED: SNARE-interacting protein KEULE-like [Erythranthe guttatus] gi|604318252|gb|EYU29850.1| hypothetical protein MIMGU_mgv1a003816mg [Erythranthe guttata] Length = 562 Score = 79.0 bits (193), Expect = 3e-12 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +3 Query: 627 RDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 RDG ELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK Sbjct: 245 RDGGELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 284 >gb|EYU28980.1| hypothetical protein MIMGU_mgv1a0251092mg, partial [Erythranthe guttata] Length = 642 Score = 79.0 bits (193), Expect = 3e-12 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +3 Query: 627 RDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 RDG ELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK Sbjct: 325 RDGGELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 364 >ref|XP_010934674.1| PREDICTED: SNARE-interacting protein KEULE-like [Elaeis guineensis] Length = 666 Score = 77.8 bits (190), Expect = 6e-12 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 621 SFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 S RDGSE+STRDLQKMVQALPQYS+QIEKLSLHV+IAGKINK Sbjct: 350 SSRDGSEISTRDLQKMVQALPQYSDQIEKLSLHVEIAGKINK 391 >ref|XP_008791331.1| PREDICTED: SNARE-interacting protein KEULE [Phoenix dactylifera] Length = 665 Score = 77.8 bits (190), Expect = 6e-12 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 621 SFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 S RDGSE+STRDLQKMVQALPQYS+QIEKLSLHV+IAGKINK Sbjct: 349 SSRDGSEISTRDLQKMVQALPQYSDQIEKLSLHVEIAGKINK 390 >ref|XP_012574806.1| PREDICTED: protein transport Sec1a-like isoform X3 [Cicer arietinum] Length = 586 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 621 SFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 S RDGSELSTRDLQKMVQALPQY+EQ+EK+SLHV+IAGKINK Sbjct: 265 SGRDGSELSTRDLQKMVQALPQYTEQVEKISLHVEIAGKINK 306 >gb|KHN40152.1| Putative ATP-dependent RNA helicase kurz [Glycine soja] Length = 1794 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 621 SFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 S RDGSELSTRDLQKMVQALPQY+EQ+EK+SLHV+IAGKINK Sbjct: 194 SGRDGSELSTRDLQKMVQALPQYTEQVEKISLHVEIAGKINK 235 >gb|KHM98888.1| Protein transport Sec1a [Glycine soja] Length = 626 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 621 SFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 S RDGSELSTRDLQKMVQALPQY+EQ+EK+SLHV+IAGKINK Sbjct: 332 SGRDGSELSTRDLQKMVQALPQYTEQVEKISLHVEIAGKINK 373 >ref|XP_010053400.1| PREDICTED: SNARE-interacting protein KEULE [Eucalyptus grandis] gi|629112726|gb|KCW77686.1| hypothetical protein EUGRSUZ_D01986 [Eucalyptus grandis] Length = 662 Score = 77.0 bits (188), Expect = 1e-11 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +3 Query: 618 ISFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 I RDGSELSTRDLQKMVQALPQYSEQI+KLSLHV+IAGKIN+ Sbjct: 346 IQQRDGSELSTRDLQKMVQALPQYSEQIDKLSLHVEIAGKINR 388 >gb|KCW77685.1| hypothetical protein EUGRSUZ_D01986 [Eucalyptus grandis] Length = 661 Score = 77.0 bits (188), Expect = 1e-11 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +3 Query: 618 ISFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 I RDGSELSTRDLQKMVQALPQYSEQI+KLSLHV+IAGKIN+ Sbjct: 346 IQQRDGSELSTRDLQKMVQALPQYSEQIDKLSLHVEIAGKINR 388 >ref|XP_006574263.1| PREDICTED: protein transport Sec1a-like [Glycine max] Length = 880 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 621 SFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 S RDGSELSTRDLQKMVQALPQY+EQ+EK+SLHV+IAGKINK Sbjct: 560 SGRDGSELSTRDLQKMVQALPQYTEQVEKISLHVEIAGKINK 601 >ref|XP_004513139.1| PREDICTED: protein transport Sec1a-like isoform X2 [Cicer arietinum] Length = 588 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 621 SFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 S RDGSELSTRDLQKMVQALPQY+EQ+EK+SLHV+IAGKINK Sbjct: 267 SGRDGSELSTRDLQKMVQALPQYTEQVEKISLHVEIAGKINK 308 >ref|XP_004513137.1| PREDICTED: protein transport Sec1a-like isoform X1 [Cicer arietinum] Length = 671 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 621 SFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 S RDGSELSTRDLQKMVQALPQY+EQ+EK+SLHV+IAGKINK Sbjct: 350 SGRDGSELSTRDLQKMVQALPQYTEQVEKISLHVEIAGKINK 391 >ref|XP_004506504.1| PREDICTED: protein transport Sec1a-like [Cicer arietinum] Length = 671 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 621 SFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 S RDGSELSTRDLQKMVQALPQY+EQ+EK+SLHV+IAGKINK Sbjct: 350 SGRDGSELSTRDLQKMVQALPQYTEQVEKISLHVEIAGKINK 391 >ref|XP_003521950.1| PREDICTED: protein transport Sec1a-like [Glycine max] Length = 669 Score = 77.0 bits (188), Expect = 1e-11 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 621 SFRDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 S RDGSELSTRDLQKMVQALPQY+EQ+EK+SLHV+IAGKINK Sbjct: 349 SGRDGSELSTRDLQKMVQALPQYTEQVEKISLHVEIAGKINK 390 >emb|CDP09881.1| unnamed protein product [Coffea canephora] Length = 672 Score = 76.3 bits (186), Expect = 2e-11 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 627 RDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 RDG ELSTR+LQKMVQALPQYSEQIEKLSLHVDIAGKIN+ Sbjct: 350 RDGGELSTRELQKMVQALPQYSEQIEKLSLHVDIAGKINR 389 >ref|XP_011069844.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X3 [Sesamum indicum] Length = 579 Score = 75.9 bits (185), Expect = 2e-11 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 627 RDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 R GSELSTRDLQ+MVQALPQYSEQIEKLSLHVDIAGKINK Sbjct: 265 RVGSELSTRDLQRMVQALPQYSEQIEKLSLHVDIAGKINK 304 >ref|XP_011069837.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X2 [Sesamum indicum] Length = 618 Score = 75.9 bits (185), Expect = 2e-11 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 627 RDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 R GSELSTRDLQ+MVQALPQYSEQIEKLSLHVDIAGKINK Sbjct: 304 RVGSELSTRDLQRMVQALPQYSEQIEKLSLHVDIAGKINK 343 >ref|XP_011069828.1| PREDICTED: SNARE-interacting protein KEULE-like isoform X1 [Sesamum indicum] Length = 664 Score = 75.9 bits (185), Expect = 2e-11 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 627 RDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 R GSELSTRDLQ+MVQALPQYSEQIEKLSLHVDIAGKINK Sbjct: 350 RVGSELSTRDLQRMVQALPQYSEQIEKLSLHVDIAGKINK 389 >ref|XP_009764743.1| PREDICTED: SNARE-interacting protein KEULE isoform X3 [Nicotiana sylvestris] Length = 581 Score = 75.9 bits (185), Expect = 2e-11 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 627 RDGSELSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKINK 746 RDG +LSTRDLQKMVQALPQYSEQIEKLSLHVDIAGK+N+ Sbjct: 266 RDGGQLSTRDLQKMVQALPQYSEQIEKLSLHVDIAGKLNR 305