BLASTX nr result
ID: Forsythia21_contig00000904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00000904 (287 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006298135.1| hypothetical protein CARUB_v10014182mg [Caps... 112 1e-22 dbj|BAC41957.1| putative heat shock protein [Arabidopsis thaliana] 112 1e-22 ref|NP_187503.1| DnaJ domain-containing protein [Arabidopsis tha... 112 1e-22 gb|AAM67147.1| putative heat shock protein [Arabidopsis thaliana] 112 1e-22 ref|XP_004506751.1| PREDICTED: dnaJ homolog subfamily B member 1... 111 2e-22 ref|XP_002884704.1| hypothetical protein ARALYDRAFT_897029 [Arab... 110 3e-22 ref|XP_009778375.1| PREDICTED: dnaJ homolog subfamily B member 4... 110 4e-22 ref|XP_009598062.1| PREDICTED: dnaJ homolog subfamily B member 4... 110 4e-22 ref|XP_006365599.1| PREDICTED: dnaJ homolog subfamily B member 4... 110 4e-22 ref|XP_004487195.1| PREDICTED: dnaJ homolog subfamily B member 1... 110 4e-22 ref|XP_004246761.1| PREDICTED: dnaJ homolog subfamily B member 1... 110 4e-22 ref|XP_010093957.1| DnaJ homolog subfamily B member 13 [Morus no... 110 5e-22 ref|XP_012468504.1| PREDICTED: dnaJ homolog subfamily B member 1... 110 5e-22 ref|XP_010916015.1| PREDICTED: dnaJ homolog subfamily B member 1... 110 5e-22 gb|KHG27416.1| DnaJ subfamily B member 13 [Gossypium arboreum] 110 5e-22 ref|XP_008455490.1| PREDICTED: dnaJ homolog subfamily B member 1... 110 5e-22 gb|KEH39190.1| DnaJ heat shock family protein [Medicago truncatula] 110 5e-22 ref|XP_002528086.1| Protein SIS1, putative [Ricinus communis] gi... 110 5e-22 ref|XP_004144520.1| PREDICTED: dnaJ homolog subfamily B member 1... 110 5e-22 ref|XP_010486439.1| PREDICTED: dnaJ homolog subfamily B member 1... 109 6e-22 >ref|XP_006298135.1| hypothetical protein CARUB_v10014182mg [Capsella rubella] gi|482566844|gb|EOA31033.1| hypothetical protein CARUB_v10014182mg [Capsella rubella] Length = 324 Score = 112 bits (279), Expect = 1e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 53 >dbj|BAC41957.1| putative heat shock protein [Arabidopsis thaliana] Length = 57 Score = 112 bits (279), Expect = 1e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 53 >ref|NP_187503.1| DnaJ domain-containing protein [Arabidopsis thaliana] gi|6403504|gb|AAF07844.1|AC010871_20 putative heat shock protein [Arabidopsis thaliana] gi|208879540|gb|ACI31315.1| At3g08910 [Arabidopsis thaliana] gi|332641173|gb|AEE74694.1| DnaJ domain-containing protein [Arabidopsis thaliana] Length = 323 Score = 112 bits (279), Expect = 1e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 53 >gb|AAM67147.1| putative heat shock protein [Arabidopsis thaliana] Length = 323 Score = 112 bits (279), Expect = 1e-22 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 53 >ref|XP_004506751.1| PREDICTED: dnaJ homolog subfamily B member 1-like [Cicer arietinum] Length = 341 Score = 111 bits (277), Expect = 2e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MG+DYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA Sbjct: 1 MGIDYYKILQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 53 >ref|XP_002884704.1| hypothetical protein ARALYDRAFT_897029 [Arabidopsis lyrata subsp. lyrata] gi|297330544|gb|EFH60963.1| hypothetical protein ARALYDRAFT_897029 [Arabidopsis lyrata subsp. lyrata] Length = 324 Score = 110 bits (276), Expect = 3e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAE+KFKQISEA Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAESKFKQISEA 53 >ref|XP_009778375.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Nicotiana sylvestris] Length = 343 Score = 110 bits (275), Expect = 4e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAK+DDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA Sbjct: 1 MGVDYYKVLQVDRNAKEDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 53 >ref|XP_009598062.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis] Length = 343 Score = 110 bits (275), Expect = 4e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFK+ISEA Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKKISEA 53 >ref|XP_006365599.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Solanum tuberosum] Length = 340 Score = 110 bits (275), Expect = 4e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKK+AEAKFKQISEA Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEA 53 >ref|XP_004487195.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Cicer arietinum] Length = 339 Score = 110 bits (275), Expect = 4e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKK+AEAKFKQISEA Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEA 53 >ref|XP_004246761.1| PREDICTED: dnaJ homolog subfamily B member 13 [Solanum lycopersicum] Length = 340 Score = 110 bits (275), Expect = 4e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKK+AEAKFKQISEA Sbjct: 1 MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEA 53 >ref|XP_010093957.1| DnaJ homolog subfamily B member 13 [Morus notabilis] gi|587865394|gb|EXB54944.1| DnaJ homolog subfamily B member 13 [Morus notabilis] Length = 346 Score = 110 bits (274), Expect = 5e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKK+AEAKFKQISEA Sbjct: 1 MGVDYYKILQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEA 53 >ref|XP_012468504.1| PREDICTED: dnaJ homolog subfamily B member 13 [Gossypium raimondii] gi|763749623|gb|KJB17062.1| hypothetical protein B456_002G263200 [Gossypium raimondii] Length = 340 Score = 110 bits (274), Expect = 5e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKD+DLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA Sbjct: 1 MGVDYYKILQVDRNAKDEDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 53 >ref|XP_010916015.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Elaeis guineensis] Length = 341 Score = 110 bits (274), Expect = 5e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKK+AEAKFKQISEA Sbjct: 1 MGVDYYKILQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEA 53 >gb|KHG27416.1| DnaJ subfamily B member 13 [Gossypium arboreum] Length = 340 Score = 110 bits (274), Expect = 5e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKD+DLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA Sbjct: 1 MGVDYYKILQVDRNAKDEDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 53 >ref|XP_008455490.1| PREDICTED: dnaJ homolog subfamily B member 1 [Cucumis melo] Length = 339 Score = 110 bits (274), Expect = 5e-22 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MG+DYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKK+AEAKFKQISEA Sbjct: 1 MGIDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEA 53 >gb|KEH39190.1| DnaJ heat shock family protein [Medicago truncatula] Length = 336 Score = 110 bits (274), Expect = 5e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKK+AEAKFKQISEA Sbjct: 1 MGVDYYKLLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEA 53 >ref|XP_002528086.1| Protein SIS1, putative [Ricinus communis] gi|223532475|gb|EEF34265.1| Protein SIS1, putative [Ricinus communis] Length = 339 Score = 110 bits (274), Expect = 5e-22 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDD+LKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA Sbjct: 1 MGVDYYKILQVDRNAKDDELKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 53 >ref|XP_004144520.1| PREDICTED: dnaJ homolog subfamily B member 1 [Cucumis sativus] gi|700188239|gb|KGN43472.1| hypothetical protein Csa_7G039200 [Cucumis sativus] Length = 339 Score = 110 bits (274), Expect = 5e-22 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MG+DYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKK+AEAKFKQISEA Sbjct: 1 MGIDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEA 53 >ref|XP_010486439.1| PREDICTED: dnaJ homolog subfamily B member 1-like [Camelina sativa] Length = 329 Score = 109 bits (273), Expect = 6e-22 Identities = 51/53 (96%), Positives = 51/53 (96%) Frame = -1 Query: 161 MGVDYYKTLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEA 3 MGVDYYK LQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNK DAEAKFKQISEA Sbjct: 1 MGVDYYKLLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKNDAEAKFKQISEA 53