BLASTX nr result
ID: Forsythia21_contig00000076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00000076 (346 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099313.1| PREDICTED: transcription factor MYB44-like [... 61 3e-07 emb|CDP02540.1| unnamed protein product [Coffea canephora] 57 6e-06 >ref|XP_011099313.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum] Length = 360 Score = 60.8 bits (146), Expect = 3e-07 Identities = 32/64 (50%), Positives = 38/64 (59%) Frame = -3 Query: 224 IQSQTPINQKVAFGSTSVXXXXXXXXXXXXXXQDKVFVPFTAELMSVMQDMIRTEVRNYM 45 +Q PIN +V FGS DK+F+PF+AELM+VMQDMIR EVRNYM Sbjct: 265 LQPHAPINNRVGFGSPVTAPAPPLPQEQ-----DKIFMPFSAELMAVMQDMIRAEVRNYM 319 Query: 44 MGLE 33 G E Sbjct: 320 AGFE 323 >emb|CDP02540.1| unnamed protein product [Coffea canephora] Length = 365 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 125 DKVFVPFTAELMSVMQDMIRTEVRNYMMGLE 33 DKVFVPFT EL++VMQ+MIR EVRNYMMG+E Sbjct: 279 DKVFVPFTGELLAVMQEMIRNEVRNYMMGME 309