BLASTX nr result
ID: Ephedra29_contig00025940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00025940 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONM00811.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea may... 57 1e-07 ONM00847.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 1e-07 ONM00816.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea may... 57 1e-07 ONM00843.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 1e-07 ONM00812.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea may... 57 1e-07 ONM00844.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 1e-07 ONM00823.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 1e-07 ONM00834.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 1e-07 ONM00836.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 1e-07 ONM00815.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea may... 57 1e-07 ONM00832.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 1e-07 ONM00838.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 1e-07 ONM00842.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 2e-07 ONM00824.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 2e-07 ONM00845.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 2e-07 ONM00810.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea may... 57 2e-07 ONM00817.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea may... 57 2e-07 ONM00821.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] 57 2e-07 XP_002448892.1 hypothetical protein SORBIDRAFT_05g000980 [Sorghu... 54 2e-06 XP_017185873.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized p... 54 2e-06 >ONM00811.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00826.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 531 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 282 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 341 Query: 182 IS 187 +S Sbjct: 342 LS 343 >ONM00847.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 818 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 569 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 628 Query: 182 IS 187 +S Sbjct: 629 LS 630 >ONM00816.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00831.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 943 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 694 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 753 Query: 182 IS 187 +S Sbjct: 754 LS 755 >ONM00843.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1207 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 958 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1017 Query: 182 IS 187 +S Sbjct: 1018 LS 1019 >ONM00812.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00814.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00839.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1293 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1044 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1103 Query: 182 IS 187 +S Sbjct: 1104 LS 1105 >ONM00844.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1300 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1051 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1110 Query: 182 IS 187 +S Sbjct: 1111 LS 1112 >ONM00823.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1304 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1055 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1114 Query: 182 IS 187 +S Sbjct: 1115 LS 1116 >ONM00834.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1361 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1112 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1171 Query: 182 IS 187 +S Sbjct: 1172 LS 1173 >ONM00836.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1511 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1262 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1321 Query: 182 IS 187 +S Sbjct: 1322 LS 1323 >ONM00815.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00846.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1528 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1279 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1338 Query: 182 IS 187 +S Sbjct: 1339 LS 1340 >ONM00832.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1591 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1342 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1401 Query: 182 IS 187 +S Sbjct: 1402 LS 1403 >ONM00838.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1607 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1358 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1417 Query: 182 IS 187 +S Sbjct: 1418 LS 1419 >ONM00842.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1621 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1372 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1431 Query: 182 IS 187 +S Sbjct: 1432 LS 1433 >ONM00824.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1634 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1385 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1444 Query: 182 IS 187 +S Sbjct: 1445 LS 1446 >ONM00845.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1652 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1403 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1462 Query: 182 IS 187 +S Sbjct: 1463 LS 1464 >ONM00810.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00813.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00818.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00819.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00827.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00828.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00829.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00841.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1656 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1407 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1466 Query: 182 IS 187 +S Sbjct: 1467 LS 1468 >ONM00817.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] ONM00822.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1663 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1414 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1473 Query: 182 IS 187 +S Sbjct: 1474 LS 1475 >ONM00821.1 hypothetical protein ZEAMMB73_Zm00001d030340 [Zea mays] Length = 1797 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/62 (43%), Positives = 38/62 (61%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++GN K + CP + KEE+ NEKP + K GWF AS Sbjct: 1548 EIIIHLLAFISKGSVKTGNASKWNSSFFCPAVIKEEVALNEKPPLICSKYGWFRFAASCT 1607 Query: 182 IS 187 +S Sbjct: 1608 LS 1609 >XP_002448892.1 hypothetical protein SORBIDRAFT_05g000980 [Sorghum bicolor] Length = 773 Score = 53.5 bits (127), Expect = 2e-06 Identities = 29/78 (37%), Positives = 43/78 (55%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E I+HLL+FI+K +++G+ + CP + KEE+ NEKP + K GWF AS Sbjct: 524 EIIIHLLAFISKGSVKTGDASNWNSSFFCPAVIKEEVALNEKPPLICSKYGWFKFAAS-- 581 Query: 182 ISKSRKTTLSQQSVTANP 235 TLS +V+ +P Sbjct: 582 ------CTLSTAAVSVSP 593 >XP_017185873.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103428372 [Malus domestica] Length = 1053 Score = 53.5 bits (127), Expect = 2e-06 Identities = 29/73 (39%), Positives = 43/73 (58%) Frame = +2 Query: 2 EPILHLLSFIAKEGIQSGNIGKGSVVLHCPPLQKEEMIANEKPSALNCKSGWFSVLASSQ 181 E +HLL+FI++ + G S L CP + KEE +KPS +N KSGWF++ A S Sbjct: 828 EKSIHLLAFISRGTQRLGEPSSLSAPLLCPSVLKEEFDGCKKPSFINSKSGWFALSALSC 887 Query: 182 ISKSRKTTLSQQS 220 +SK + +T+ S Sbjct: 888 VSKPKFSTIPTTS 900