BLASTX nr result
ID: Ephedra29_contig00012452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00012452 (346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBI28516.3 unnamed protein product, partial [Vitis vinifera] 111 1e-28 ACJ83895.1 unknown [Medicago truncatula] AFK45833.1 unknown [Med... 107 3e-28 XP_015970897.1 PREDICTED: AP-1 complex subunit sigma-1 [Arachis ... 109 4e-28 ACJ84193.1 unknown [Medicago truncatula] 109 4e-28 XP_006284550.1 hypothetical protein CARUB_v10005766mg, partial [... 110 6e-28 AFK42603.1 unknown [Medicago truncatula] 107 8e-28 KMZ69954.1 AP-1 complex subunit sigma-1 [Zostera marina] 108 8e-28 KJB47152.1 hypothetical protein B456_008G012700 [Gossypium raimo... 106 2e-27 OAY29031.1 hypothetical protein MANES_15G112700 [Manihot esculenta] 107 2e-27 XP_015883677.1 PREDICTED: AP-1 complex subunit sigma-2 isoform X... 107 2e-27 XP_011622608.1 PREDICTED: AP-1 complex subunit sigma-1 [Amborell... 107 2e-27 XP_010272948.1 PREDICTED: AP-1 complex subunit sigma-1 [Nelumbo ... 107 2e-27 XP_002263114.1 PREDICTED: AP-1 complex subunit sigma-2 [Vitis vi... 107 2e-27 XP_006486549.1 PREDICTED: AP-1 complex subunit sigma-1 isoform X... 107 2e-27 XP_006422372.1 hypothetical protein CICLE_v10029448mg [Citrus cl... 107 2e-27 XP_004502012.1 PREDICTED: AP-1 complex subunit sigma-1 [Cicer ar... 107 2e-27 XP_003618095.1 clathrin adaptor complex small chain [Medicago tr... 107 2e-27 CBI22701.3 unnamed protein product, partial [Vitis vinifera] 108 2e-27 ERN04041.1 hypothetical protein AMTR_s00079p00186170 [Amborella ... 107 2e-27 XP_017981102.1 PREDICTED: AP-1 complex subunit sigma-2 isoform X... 106 2e-27 >CBI28516.3 unnamed protein product, partial [Vitis vinifera] Length = 178 Score = 111 bits (277), Expect = 1e-28 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -2 Query: 168 LKTMIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 LK MIHFVLLISRQGKVRLTKWYSPYSQKER+K+IRELSGVILTR PKLCNFVEWR Sbjct: 15 LKVMIHFVLLISRQGKVRLTKWYSPYSQKERTKVIRELSGVILTRGPKLCNFVEWR 70 >ACJ83895.1 unknown [Medicago truncatula] AFK45833.1 unknown [Medicago truncatula] Length = 104 Score = 107 bits (268), Expect = 3e-28 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPY+QKERSK+IRELSGVIL+RAPKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGVILSRAPKLCNFVEWR 53 >XP_015970897.1 PREDICTED: AP-1 complex subunit sigma-1 [Arachis duranensis] XP_016161968.1 PREDICTED: AP-1 complex subunit sigma-1 [Arachis ipaensis] Length = 161 Score = 109 bits (272), Expect = 4e-28 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPY+QKERSK+IRELSGVILTRAPKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGVILTRAPKLCNFVEWR 53 >ACJ84193.1 unknown [Medicago truncatula] Length = 161 Score = 109 bits (272), Expect = 4e-28 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPY+QKERSK+IRELSGVILTRAPKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGVILTRAPKLCNFVEWR 53 >XP_006284550.1 hypothetical protein CARUB_v10005766mg, partial [Capsella rubella] EOA17448.1 hypothetical protein CARUB_v10005766mg, partial [Capsella rubella] Length = 201 Score = 110 bits (274), Expect = 6e-28 Identities = 51/66 (77%), Positives = 56/66 (84%) Frame = -2 Query: 198 FCVIALLAQDLKTMIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLC 19 FC + +TMIHFVLL+SRQGKVRLTKWYSPY+QKERSK+IRELSGVIL R PKLC Sbjct: 28 FCYRFVYVVSYETMIHFVLLVSRQGKVRLTKWYSPYAQKERSKVIRELSGVILNRGPKLC 87 Query: 18 NFVEWR 1 NFVEWR Sbjct: 88 NFVEWR 93 >AFK42603.1 unknown [Medicago truncatula] Length = 134 Score = 107 bits (268), Expect = 8e-28 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPY+QKERSK+IRELSGVIL+RAPKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGVILSRAPKLCNFVEWR 53 >KMZ69954.1 AP-1 complex subunit sigma-1 [Zostera marina] Length = 161 Score = 108 bits (270), Expect = 8e-28 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPY QKERSK+IRELSGVILTRAPKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYHQKERSKVIRELSGVILTRAPKLCNFVEWR 53 >KJB47152.1 hypothetical protein B456_008G012700 [Gossypium raimondii] Length = 121 Score = 106 bits (265), Expect = 2e-27 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPYSQKER+K+IRELSG+ILTR PKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYSQKERTKVIRELSGLILTRGPKLCNFVEWR 53 >OAY29031.1 hypothetical protein MANES_15G112700 [Manihot esculenta] Length = 161 Score = 107 bits (268), Expect = 2e-27 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPYSQKER+K+IRELSGVILTR PKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYSQKERTKVIRELSGVILTRGPKLCNFVEWR 53 >XP_015883677.1 PREDICTED: AP-1 complex subunit sigma-2 isoform X1 [Ziziphus jujuba] XP_015883678.1 PREDICTED: AP-1 complex subunit sigma-2 isoform X2 [Ziziphus jujuba] Length = 161 Score = 107 bits (268), Expect = 2e-27 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPYSQKER+K+IRELSGVILTR PKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYSQKERTKVIRELSGVILTRGPKLCNFVEWR 53 >XP_011622608.1 PREDICTED: AP-1 complex subunit sigma-1 [Amborella trichopoda] Length = 161 Score = 107 bits (268), Expect = 2e-27 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPYSQKER+K+IRELSGVILTR PKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYSQKERTKVIRELSGVILTRGPKLCNFVEWR 53 >XP_010272948.1 PREDICTED: AP-1 complex subunit sigma-1 [Nelumbo nucifera] Length = 161 Score = 107 bits (268), Expect = 2e-27 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPYSQKER+K+IRELSGVILTR PKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYSQKERTKVIRELSGVILTRGPKLCNFVEWR 53 >XP_002263114.1 PREDICTED: AP-1 complex subunit sigma-2 [Vitis vinifera] Length = 161 Score = 107 bits (268), Expect = 2e-27 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPYSQKER+K+IRELSGVILTR PKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYSQKERTKVIRELSGVILTRGPKLCNFVEWR 53 >XP_006486549.1 PREDICTED: AP-1 complex subunit sigma-1 isoform X1 [Citrus sinensis] XP_006486550.1 PREDICTED: AP-1 complex subunit sigma-1 isoform X2 [Citrus sinensis] Length = 161 Score = 107 bits (268), Expect = 2e-27 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPY+QKERSK+IRELSGVILTR PKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGVILTRGPKLCNFVEWR 53 >XP_006422372.1 hypothetical protein CICLE_v10029448mg [Citrus clementina] ESR35612.1 hypothetical protein CICLE_v10029448mg [Citrus clementina] KDO68438.1 hypothetical protein CISIN_1g031366mg [Citrus sinensis] KDO68439.1 hypothetical protein CISIN_1g031366mg [Citrus sinensis] Length = 161 Score = 107 bits (268), Expect = 2e-27 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPY+QKERSK+IRELSGVILTR PKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGVILTRGPKLCNFVEWR 53 >XP_004502012.1 PREDICTED: AP-1 complex subunit sigma-1 [Cicer arietinum] XP_004506805.1 PREDICTED: AP-1 complex subunit sigma-1 isoform X1 [Cicer arietinum] Length = 161 Score = 107 bits (268), Expect = 2e-27 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPY+QKERSK+IRELSGVIL+RAPKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGVILSRAPKLCNFVEWR 53 >XP_003618095.1 clathrin adaptor complex small chain [Medicago truncatula] AET01054.1 clathrin adaptor complex small chain [Medicago truncatula] AFK41228.1 unknown [Medicago truncatula] Length = 161 Score = 107 bits (268), Expect = 2e-27 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPY+QKERSK+IRELSGVIL+RAPKLCNFVEWR Sbjct: 1 MIHFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGVILSRAPKLCNFVEWR 53 >CBI22701.3 unnamed protein product, partial [Vitis vinifera] Length = 190 Score = 108 bits (270), Expect = 2e-27 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -2 Query: 168 LKTMIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 L+ MIHFVLLISRQGKVRLTKWYSPY+QKER+K+IRELSGVILTR PKLCNFVEWR Sbjct: 27 LEAMIHFVLLISRQGKVRLTKWYSPYTQKERTKVIRELSGVILTRGPKLCNFVEWR 82 >ERN04041.1 hypothetical protein AMTR_s00079p00186170 [Amborella trichopoda] Length = 167 Score = 107 bits (268), Expect = 2e-27 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLLISRQGKVRLTKWYSPYSQKER+K+IRELSGVILTR PKLCNFVEWR Sbjct: 7 MIHFVLLISRQGKVRLTKWYSPYSQKERTKVIRELSGVILTRGPKLCNFVEWR 59 >XP_017981102.1 PREDICTED: AP-1 complex subunit sigma-2 isoform X2 [Theobroma cacao] Length = 132 Score = 106 bits (265), Expect = 2e-27 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = -2 Query: 159 MIHFVLLISRQGKVRLTKWYSPYSQKERSKIIRELSGVILTRAPKLCNFVEWR 1 MIHFVLL+SRQGKVRLTKWYSPYSQKERSK+IRELSG+IL+R PKLCNFVEWR Sbjct: 1 MIHFVLLVSRQGKVRLTKWYSPYSQKERSKVIRELSGIILSRGPKLCNFVEWR 53