BLASTX nr result
ID: Ephedra29_contig00009642
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra29_contig00009642 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERN12819.1 hypothetical protein AMTR_s00180p00024800 [Amborella ... 53 2e-06 XP_006851238.2 PREDICTED: uncharacterized protein LOC18441051 [A... 53 2e-06 >ERN12819.1 hypothetical protein AMTR_s00180p00024800 [Amborella trichopoda] Length = 103 Score = 53.1 bits (126), Expect = 2e-06 Identities = 22/42 (52%), Positives = 33/42 (78%) Frame = -1 Query: 422 IPEIHSNIQRTLDQGFRYHHKTWKLINAVRSNSIKVTDSDGL 297 IPEI+SNIQ+ LD+GF+ H K W LINA++++ +K+ D + L Sbjct: 62 IPEIYSNIQKELDKGFKNHTKIWSLINALKNHGVKLIDDNRL 103 >XP_006851238.2 PREDICTED: uncharacterized protein LOC18441051 [Amborella trichopoda] Length = 113 Score = 53.1 bits (126), Expect = 2e-06 Identities = 22/42 (52%), Positives = 33/42 (78%) Frame = -1 Query: 422 IPEIHSNIQRTLDQGFRYHHKTWKLINAVRSNSIKVTDSDGL 297 IPEI+SNIQ+ LD+GF+ H K W LINA++++ +K+ D + L Sbjct: 72 IPEIYSNIQKELDKGFKNHTKIWSLINALKNHGVKLIDDNRL 113