BLASTX nr result
ID: Ephedra27_contig00030518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00030518 (350 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004505749.1| PREDICTED: uncharacterized protein LOC101510... 56 6e-06 ref|XP_004505748.1| PREDICTED: uncharacterized protein LOC101510... 56 6e-06 >ref|XP_004505749.1| PREDICTED: uncharacterized protein LOC101510730 isoform X2 [Cicer arietinum] Length = 590 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = -3 Query: 252 RVCDPNDRWYLADNTFSPDDILPLIGRCLDHAMTGLHP 139 +VCDPN RWYLAD+ P D+L + GR L HA GLHP Sbjct: 277 QVCDPNGRWYLADSGSGPGDLLLITGRALSHATAGLHP 314 >ref|XP_004505748.1| PREDICTED: uncharacterized protein LOC101510730 isoform X1 [Cicer arietinum] Length = 593 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = -3 Query: 252 RVCDPNDRWYLADNTFSPDDILPLIGRCLDHAMTGLHP 139 +VCDPN RWYLAD+ P D+L + GR L HA GLHP Sbjct: 277 QVCDPNGRWYLADSGSGPGDLLLITGRALSHATAGLHP 314