BLASTX nr result
ID: Ephedra27_contig00016500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00016500 (362 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320061.2| hypothetical protein POPTR_0014s06500g [Popu... 58 1e-06 >ref|XP_002320061.2| hypothetical protein POPTR_0014s06500g [Populus trichocarpa] gi|550323645|gb|EEE98376.2| hypothetical protein POPTR_0014s06500g [Populus trichocarpa] Length = 435 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 358 MAWSPKSVPTDTGMTTLLATASVDKKVKFWAAPKLR 251 +AW+PK +PT G T++LATASVDKKVK WAAP LR Sbjct: 398 IAWAPKPIPTGDGQTSILATASVDKKVKLWAAPPLR 433