BLASTX nr result
ID: Ephedra27_contig00007584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00007584 (673 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006414437.1| hypothetical protein EUTSA_v10024402mg [Eutr... 57 5e-06 ref|XP_006283110.1| hypothetical protein CARUB_v10004128mg [Caps... 57 5e-06 ref|XP_002870206.1| predicted protein [Arabidopsis lyrata subsp.... 57 5e-06 ref|NP_193319.6| BTB/POZ domain-containing protein [Arabidopsis ... 57 5e-06 >ref|XP_006414437.1| hypothetical protein EUTSA_v10024402mg [Eutrema salsugineum] gi|557115607|gb|ESQ55890.1| hypothetical protein EUTSA_v10024402mg [Eutrema salsugineum] Length = 836 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -1 Query: 673 WAFLCVHAATELLHVLPKLSLEVLCRLLKSDEMWIPNEHERF 548 W +LC A EL +LPKLS + LC LL SDE+WIP+E +RF Sbjct: 204 WGYLCQSGAMELREMLPKLSAQTLCALLTSDELWIPSEEKRF 245 >ref|XP_006283110.1| hypothetical protein CARUB_v10004128mg [Capsella rubella] gi|482551815|gb|EOA16008.1| hypothetical protein CARUB_v10004128mg [Capsella rubella] Length = 833 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -1 Query: 673 WAFLCVHAATELLHVLPKLSLEVLCRLLKSDEMWIPNEHERF 548 W +LC A EL +LPKLS + LC LL SDE+W+P+E +RF Sbjct: 201 WGYLCQSGAVELREMLPKLSAQTLCALLTSDELWVPSEEKRF 242 >ref|XP_002870206.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297316042|gb|EFH46465.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 723 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -1 Query: 673 WAFLCVHAATELLHVLPKLSLEVLCRLLKSDEMWIPNEHERF 548 W +LC A EL +LPKLS + LC LL SDE+W+P+E +RF Sbjct: 91 WGYLCQSGAVELREMLPKLSAQTLCALLTSDELWVPSEEKRF 132 >ref|NP_193319.6| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|332658258|gb|AEE83658.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] Length = 836 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -1 Query: 673 WAFLCVHAATELLHVLPKLSLEVLCRLLKSDEMWIPNEHERF 548 W +LC A EL +LPKLS + LC LL SDE+W+P+E +RF Sbjct: 204 WGYLCQSGAVELREMLPKLSAQTLCALLTSDELWVPSEEKRF 245