BLASTX nr result
ID: Ephedra25_contig00028800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00028800 (598 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446876.1| hypothetical protein CICLE_v10017898mg [Citr... 91 2e-16 ref|XP_001775099.1| predicted protein [Physcomitrella patens] gi... 90 4e-16 gb|EOY29048.1| Tetratricopeptide repeat-like superfamily protein... 89 9e-16 ref|XP_002977643.1| hypothetical protein SELMODRAFT_107700 [Sela... 89 9e-16 ref|XP_002979631.1| hypothetical protein SELMODRAFT_110838 [Sela... 89 9e-16 gb|ABK26521.1| unknown [Picea sitchensis] 89 9e-16 gb|EMJ08613.1| hypothetical protein PRUPE_ppa014644mg [Prunus pe... 89 1e-15 gb|AEB39781.1| pentatricopeptide repeat protein 79 [Funaria hygr... 89 1e-15 ref|XP_002302824.2| hypothetical protein POPTR_0002s22590g [Popu... 88 2e-15 tpg|DAA45699.1| TPA: hypothetical protein ZEAMMB73_401104 [Zea m... 88 2e-15 ref|XP_004137278.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-15 ref|NP_567948.1| pentatricopeptide repeat-containing protein [Ar... 87 3e-15 ref|XP_002867139.1| EMB2758 [Arabidopsis lyrata subsp. lyrata] g... 87 3e-15 ref|XP_006469116.1| PREDICTED: uncharacterized protein LOC102612... 87 3e-15 gb|EOY19557.1| Pentatricopeptide repeat (PPR) superfamily protei... 87 3e-15 ref|XP_006283127.1| hypothetical protein CARUB_v10004150mg [Caps... 87 3e-15 ref|XP_004308197.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-15 gb|EMJ21454.1| hypothetical protein PRUPE_ppa001444mg [Prunus pe... 87 3e-15 gb|EMJ00195.1| hypothetical protein PRUPE_ppa002176mg [Prunus pe... 87 3e-15 gb|AEB39777.1| pentatricopeptide repeat protein 91 [Funaria hygr... 87 3e-15 >ref|XP_006446876.1| hypothetical protein CICLE_v10017898mg [Citrus clementina] gi|557549487|gb|ESR60116.1| hypothetical protein CICLE_v10017898mg [Citrus clementina] Length = 714 Score = 90.9 bits (224), Expect = 2e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATKFIS +T REI+VRDAHRFH+F+ G CSCGDYW Sbjct: 669 KNLRVCGDCHTATKFISKVTGREIVVRDAHRFHHFKDGTCSCGDYW 714 >ref|XP_001775099.1| predicted protein [Physcomitrella patens] gi|162673550|gb|EDQ60071.1| predicted protein [Physcomitrella patens] Length = 804 Score = 90.1 bits (222), Expect = 4e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+C DCH ATKFIS IT+REII RDAHRFH+F+ G+CSCGDYW Sbjct: 759 KNLRVCTDCHTATKFISKITKREIIARDAHRFHHFKNGECSCGDYW 804 >gb|EOY29048.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508781793|gb|EOY29049.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508781794|gb|EOY29050.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 675 Score = 89.0 bits (219), Expect = 9e-16 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KN+R+CGDCH+A KF+S + RREIIVRD +RFH+FRGG CSCGDYW Sbjct: 630 KNIRVCGDCHSAIKFVSQVVRREIIVRDTNRFHHFRGGSCSCGDYW 675 >ref|XP_002977643.1| hypothetical protein SELMODRAFT_107700 [Selaginella moellendorffii] gi|300154346|gb|EFJ20981.1| hypothetical protein SELMODRAFT_107700 [Selaginella moellendorffii] Length = 879 Score = 89.0 bits (219), Expect = 9e-16 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATKFIS IT REI+VRD+HRFH+F G CSCGDYW Sbjct: 834 KNLRVCGDCHTATKFISKITGREIVVRDSHRFHHFDNGTCSCGDYW 879 >ref|XP_002979631.1| hypothetical protein SELMODRAFT_110838 [Selaginella moellendorffii] gi|300152879|gb|EFJ19520.1| hypothetical protein SELMODRAFT_110838 [Selaginella moellendorffii] Length = 879 Score = 89.0 bits (219), Expect = 9e-16 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATKFIS IT REI+VRD+HRFH+F G CSCGDYW Sbjct: 834 KNLRVCGDCHTATKFISKITGREIVVRDSHRFHHFDNGTCSCGDYW 879 >gb|ABK26521.1| unknown [Picea sitchensis] Length = 370 Score = 89.0 bits (219), Expect = 9e-16 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATKFIS I REI++RD HRFH+F+ GQCSCGDYW Sbjct: 325 KNLRVCGDCHTATKFISRIVSREIVLRDTHRFHHFKDGQCSCGDYW 370 >gb|EMJ08613.1| hypothetical protein PRUPE_ppa014644mg [Prunus persica] Length = 672 Score = 88.6 bits (218), Expect = 1e-15 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH A+K IS +T REI++RDAHRFH+F+GG CSCGDYW Sbjct: 627 KNLRVCGDCHTASKLISKVTGREIVMRDAHRFHHFKGGACSCGDYW 672 >gb|AEB39781.1| pentatricopeptide repeat protein 79 [Funaria hygrometrica] Length = 820 Score = 88.6 bits (218), Expect = 1e-15 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+C DCH ATKFIS IT REII RDAHRFH+F+ G+CSCGDYW Sbjct: 775 KNLRVCTDCHTATKFISKITGREIIARDAHRFHHFKNGECSCGDYW 820 >ref|XP_002302824.2| hypothetical protein POPTR_0002s22590g [Populus trichocarpa] gi|550345610|gb|EEE82097.2| hypothetical protein POPTR_0002s22590g [Populus trichocarpa] Length = 647 Score = 88.2 bits (217), Expect = 2e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATKFIS +T REI+VRDAHRFH+F+ G CSC DYW Sbjct: 602 KNLRVCGDCHTATKFISKVTGREIVVRDAHRFHHFKNGACSCRDYW 647 >tpg|DAA45699.1| TPA: hypothetical protein ZEAMMB73_401104 [Zea mays] Length = 746 Score = 87.8 bits (216), Expect = 2e-15 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH+ATK+IS IT REIIVRDA+RFH+F+ G CSCGD+W Sbjct: 701 KNLRVCGDCHSATKYISKITEREIIVRDANRFHHFKDGHCSCGDFW 746 >ref|XP_004137278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Cucumis sativus] gi|449476583|ref|XP_004154777.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Cucumis sativus] Length = 816 Score = 87.4 bits (215), Expect = 3e-15 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATKFIS IT REIIVRD++RFH+F+ G CSCGDYW Sbjct: 771 KNLRVCGDCHNATKFISKITEREIIVRDSNRFHHFKDGVCSCGDYW 816 >ref|NP_567948.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635622|sp|O81767.2|PP348_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g33990; AltName: Full=Protein EMBRYO DEFECTIVE 2758 gi|332660906|gb|AEE86306.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 823 Score = 87.4 bits (215), Expect = 3e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH+ TKFIS IT REIIVRD++RFH+F+ G CSCGDYW Sbjct: 778 KNLRVCGDCHSVTKFISKITEREIIVRDSNRFHHFKNGVCSCGDYW 823 >ref|XP_002867139.1| EMB2758 [Arabidopsis lyrata subsp. lyrata] gi|297312975|gb|EFH43398.1| EMB2758 [Arabidopsis lyrata subsp. lyrata] Length = 824 Score = 87.4 bits (215), Expect = 3e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH+ TKFIS IT REIIVRD++RFH+F+ G CSCGDYW Sbjct: 779 KNLRVCGDCHSVTKFISKITEREIIVRDSNRFHHFKNGVCSCGDYW 824 >ref|XP_006469116.1| PREDICTED: uncharacterized protein LOC102612526 [Citrus sinensis] Length = 1508 Score = 87.0 bits (214), Expect = 3e-15 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDY 463 KNLR+CGDCH ATKFIS +T REIIVRDAHRFH+F+ G CSCGDY Sbjct: 1127 KNLRVCGDCHTATKFISKVTGREIIVRDAHRFHHFKDGTCSCGDY 1171 >gb|EOY19557.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 886 Score = 87.0 bits (214), Expect = 3e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATK+IS +T REIIVRD HRFH+F+ G CSCGDYW Sbjct: 841 KNLRVCGDCHNATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 886 >ref|XP_006283127.1| hypothetical protein CARUB_v10004150mg [Capsella rubella] gi|482551832|gb|EOA16025.1| hypothetical protein CARUB_v10004150mg [Capsella rubella] Length = 814 Score = 87.0 bits (214), Expect = 3e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH+ TKFIS IT REIIVRD++RFH+F+ G CSCGDYW Sbjct: 769 KNLRVCGDCHSVTKFISRITEREIIVRDSNRFHHFKNGVCSCGDYW 814 >ref|XP_004308197.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Fragaria vesca subsp. vesca] Length = 827 Score = 87.0 bits (214), Expect = 3e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATK+IS +T REIIVRD HRFH+F+ G CSCGDYW Sbjct: 782 KNLRVCGDCHNATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 827 >gb|EMJ21454.1| hypothetical protein PRUPE_ppa001444mg [Prunus persica] Length = 827 Score = 87.0 bits (214), Expect = 3e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATK+IS +T REIIVRD HRFH+F+ G CSCGDYW Sbjct: 782 KNLRVCGDCHNATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 827 >gb|EMJ00195.1| hypothetical protein PRUPE_ppa002176mg [Prunus persica] Length = 705 Score = 87.0 bits (214), Expect = 3e-15 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATKFIS IT REIIVRD++RFH+F+ G CSCGDYW Sbjct: 660 KNLRVCGDCHNATKFISVITEREIIVRDSNRFHHFKDGACSCGDYW 705 >gb|AEB39777.1| pentatricopeptide repeat protein 91 [Funaria hygrometrica] Length = 890 Score = 87.0 bits (214), Expect = 3e-15 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -2 Query: 597 KNLRICGDCHAATKFISSITRREIIVRDAHRFHYFRGGQCSCGDYW 460 KNLR+CGDCH ATKFIS I +REI+ RDA+RFHYF+ G CSCGD+W Sbjct: 845 KNLRVCGDCHTATKFISKIRKREIVARDANRFHYFKNGTCSCGDFW 890