BLASTX nr result
ID: Ephedra25_contig00027928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00027928 (552 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20539.1| Zinc finger CCCH domain-containing protein 14 [Mo... 72 9e-11 gb|EMJ18117.1| hypothetical protein PRUPE_ppa018479mg [Prunus pe... 71 2e-10 ref|XP_006357820.1| PREDICTED: zinc finger CCCH domain-containin... 69 6e-10 ref|XP_004300951.1| PREDICTED: zinc finger CCCH domain-containin... 69 6e-10 ref|XP_004233706.1| PREDICTED: zinc finger CCCH domain-containin... 69 6e-10 ref|XP_004138800.1| PREDICTED: zinc finger CCCH domain-containin... 69 1e-09 ref|XP_002282967.2| PREDICTED: zinc finger CCCH domain-containin... 69 1e-09 emb|CBI26957.3| unnamed protein product [Vitis vinifera] 69 1e-09 ref|XP_002526299.1| zinc finger protein, putative [Ricinus commu... 69 1e-09 ref|XP_006469094.1| PREDICTED: zinc finger CCCH domain-containin... 68 1e-09 ref|XP_006448374.1| hypothetical protein CICLE_v10015908mg [Citr... 68 1e-09 gb|EPS61813.1| hypothetical protein M569_12980 [Genlisea aurea] 68 1e-09 gb|EOY00015.1| Zinc finger C-x8-C-x5-C-x3-H type family protein,... 68 1e-09 gb|EOY00013.1| Zinc finger C-x8-C-x5-C-x3-H type family protein,... 68 1e-09 ref|XP_006654828.1| PREDICTED: zinc finger CCCH domain-containin... 68 2e-09 ref|XP_006842660.1| hypothetical protein AMTR_s00147p00005450 [A... 68 2e-09 ref|XP_006344185.1| PREDICTED: zinc finger CCCH domain-containin... 67 2e-09 gb|EOY04091.1| Zinc finger protein, putative [Theobroma cacao] 67 3e-09 ref|XP_006302558.1| hypothetical protein CARUB_v10020665mg [Caps... 67 3e-09 gb|EMT30632.1| Zinc finger CCCH domain-containing protein 9 [Aeg... 67 3e-09 >gb|EXC20539.1| Zinc finger CCCH domain-containing protein 14 [Morus notabilis] Length = 363 Score = 72.0 bits (175), Expect = 9e-11 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV SGE+CPYGHRCHFRH +T+++ Sbjct: 323 RHPRYKTEICRMVLSGERCPYGHRCHFRHSLTEQE 357 >gb|EMJ18117.1| hypothetical protein PRUPE_ppa018479mg [Prunus persica] Length = 311 Score = 70.9 bits (172), Expect = 2e-10 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKT+LCRMVA+G KCPYGHRCHFRH +T+++ Sbjct: 264 RHPRYKTQLCRMVAAGGKCPYGHRCHFRHSLTEQE 298 >ref|XP_006357820.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Solanum tuberosum] Length = 341 Score = 69.3 bits (168), Expect = 6e-10 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +T+E+ Sbjct: 299 RHPRYKTEVCRMVLAGDMCPYGHRCHFRHSLTEEE 333 >ref|XP_004300951.1| PREDICTED: zinc finger CCCH domain-containing protein 15-like [Fragaria vesca subsp. vesca] Length = 389 Score = 69.3 bits (168), Expect = 6e-10 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +T+E+ Sbjct: 340 RHPRYKTEVCRMVLAGDVCPYGHRCHFRHALTEEE 374 >ref|XP_004233706.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Solanum lycopersicum] Length = 341 Score = 69.3 bits (168), Expect = 6e-10 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +T+E+ Sbjct: 299 RHPRYKTEVCRMVLAGDMCPYGHRCHFRHSLTEEE 333 >ref|XP_004138800.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Cucumis sativus] Length = 311 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKE 103 RHPRYKT++CRMV +GEKCPYGHRCHFRH ++++ Sbjct: 278 RHPRYKTQMCRMVLAGEKCPYGHRCHFRHSLSEQ 311 >ref|XP_002282967.2| PREDICTED: zinc finger CCCH domain-containing protein 15 [Vitis vinifera] Length = 396 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +T+++ Sbjct: 347 RHPRYKTEVCRMVLAGDACPYGHRCHFRHALTEQE 381 >emb|CBI26957.3| unnamed protein product [Vitis vinifera] Length = 398 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +T+++ Sbjct: 349 RHPRYKTEVCRMVLAGDACPYGHRCHFRHALTEQE 383 >ref|XP_002526299.1| zinc finger protein, putative [Ricinus communis] gi|223534380|gb|EEF36088.1| zinc finger protein, putative [Ricinus communis] Length = 311 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH++T + Sbjct: 267 RHPRYKTEVCRMVLAGDACPYGHRCHFRHVLTDHE 301 >ref|XP_006469094.1| PREDICTED: zinc finger CCCH domain-containing protein 15-like [Citrus sinensis] Length = 327 Score = 68.2 bits (165), Expect = 1e-09 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +T+++ Sbjct: 279 RHPRYKTEVCRMVLAGDVCPYGHRCHFRHALTEQE 313 >ref|XP_006448374.1| hypothetical protein CICLE_v10015908mg [Citrus clementina] gi|557550985|gb|ESR61614.1| hypothetical protein CICLE_v10015908mg [Citrus clementina] Length = 327 Score = 68.2 bits (165), Expect = 1e-09 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +T+++ Sbjct: 279 RHPRYKTEVCRMVLAGDVCPYGHRCHFRHALTEQE 313 >gb|EPS61813.1| hypothetical protein M569_12980 [Genlisea aurea] Length = 346 Score = 68.2 bits (165), Expect = 1e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKEDN 109 RHPRYKTE+CRMV +G CPYGHRCHFRH +T ++N Sbjct: 294 RHPRYKTEVCRMVLNGVPCPYGHRCHFRHSLTDQEN 329 >gb|EOY00015.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 3 [Theobroma cacao] Length = 303 Score = 68.2 bits (165), Expect = 1e-09 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +T+++ Sbjct: 258 RHPRYKTEVCRMVLAGDVCPYGHRCHFRHALTEQE 292 >gb|EOY00013.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 1 [Theobroma cacao] gi|508708117|gb|EOY00014.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 1 [Theobroma cacao] Length = 308 Score = 68.2 bits (165), Expect = 1e-09 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +T+++ Sbjct: 263 RHPRYKTEVCRMVLAGDVCPYGHRCHFRHALTEQE 297 >ref|XP_006654828.1| PREDICTED: zinc finger CCCH domain-containing protein 39-like [Oryza brachyantha] Length = 336 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV SG CPYGHRCHFRH +T D Sbjct: 296 RHPRYKTEVCRMVLSGGVCPYGHRCHFRHSITPAD 330 >ref|XP_006842660.1| hypothetical protein AMTR_s00147p00005450 [Amborella trichopoda] gi|548844761|gb|ERN04335.1| hypothetical protein AMTR_s00147p00005450 [Amborella trichopoda] Length = 353 Score = 67.8 bits (164), Expect = 2e-09 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRM+ +G+KCPYGHRCHFRH ++ + Sbjct: 311 RHPRYKTEICRMILTGDKCPYGHRCHFRHALSPNE 345 >ref|XP_006344185.1| PREDICTED: zinc finger CCCH domain-containing protein 15-like [Solanum tuberosum] Length = 338 Score = 67.4 bits (163), Expect = 2e-09 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +T ++ Sbjct: 291 RHPRYKTEVCRMVLNGDPCPYGHRCHFRHSLTDQE 325 >gb|EOY04091.1| Zinc finger protein, putative [Theobroma cacao] Length = 312 Score = 67.0 bits (162), Expect = 3e-09 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHP+YKTE+CRMV +G+ CPYGHRCHFRH +T+++ Sbjct: 272 RHPKYKTEVCRMVLAGQTCPYGHRCHFRHSLTEQE 306 >ref|XP_006302558.1| hypothetical protein CARUB_v10020665mg [Capsella rubella] gi|482571268|gb|EOA35456.1| hypothetical protein CARUB_v10020665mg [Capsella rubella] Length = 320 Score = 67.0 bits (162), Expect = 3e-09 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVTKED 106 RHPRYKTE+CRMV +G+ CPYGHRCHFRH +++++ Sbjct: 269 RHPRYKTEVCRMVLAGDNCPYGHRCHFRHSLSEQE 303 >gb|EMT30632.1| Zinc finger CCCH domain-containing protein 9 [Aegilops tauschii] Length = 130 Score = 67.0 bits (162), Expect = 3e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 2 RHPRYKTELCRMVASGEKCPYGHRCHFRHIVT 97 RHPRYKTE+CRMV +GE CPYGHRCHFRH +T Sbjct: 90 RHPRYKTEVCRMVLNGEVCPYGHRCHFRHSLT 121