BLASTX nr result
ID: Ephedra25_contig00027628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00027628 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK25112.1| unknown [Picea sitchensis] 64 3e-08 ref|XP_006857956.1| hypothetical protein AMTR_s00069p00169640 [A... 55 1e-05 >gb|ABK25112.1| unknown [Picea sitchensis] Length = 129 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 488 HRLERSERFLKPVPLLGHLAAKAVELLIGVQTRYSYISAS 369 HRLE E+ LKPVP++G L AKAVELL+GVQTRYSYISAS Sbjct: 90 HRLEYFEQLLKPVPVIGTLIAKAVELLVGVQTRYSYISAS 129 >ref|XP_006857956.1| hypothetical protein AMTR_s00069p00169640 [Amborella trichopoda] gi|548862058|gb|ERN19423.1| hypothetical protein AMTR_s00069p00169640 [Amborella trichopoda] Length = 152 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -1 Query: 485 RLERSERFLKPVPLLGHLAAKAVELLIGVQTRYSYISAS 369 R+E +E++L P+PL+G L AK VEL+IG QTRY+Y SAS Sbjct: 114 RIENTEKYLNPIPLVGFLTAKFVELIIGAQTRYTYTSAS 152