BLASTX nr result
ID: Ephedra25_contig00026029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00026029 (731 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB52248.1| UDP-glucuronic acid decarboxylase 1 [Morus notabi... 63 9e-08 ref|NP_200737.1| UDP-glucuronic acid decarboxylase 3 [Arabidopsi... 63 9e-08 gb|ESW22302.1| hypothetical protein PHAVU_005G142500g [Phaseolus... 63 9e-08 ref|XP_006424785.1| hypothetical protein CICLE_v10028768mg [Citr... 63 9e-08 ref|XP_006409908.1| hypothetical protein EUTSA_v10016891mg [Eutr... 63 9e-08 ref|XP_006400977.1| hypothetical protein EUTSA_v10014020mg [Eutr... 63 9e-08 ref|XP_006418896.1| hypothetical protein EUTSA_v10002602mg [Eutr... 63 9e-08 ref|XP_002298368.2| UDP-GLUCURONIC ACID DECARBOXYLASE family pro... 63 9e-08 ref|XP_006846098.1| hypothetical protein AMTR_s00012p00122270 [A... 63 9e-08 gb|EOY34100.1| UDP-XYL synthase 5 isoform 5 [Theobroma cacao] 63 9e-08 gb|EOY34096.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao] gi... 63 9e-08 gb|AGK44104.1| UDP-glucuronate decarboxylase protein 3 [Populus ... 63 9e-08 ref|XP_006294492.1| hypothetical protein CARUB_v10023520mg, part... 63 9e-08 ref|XP_006291434.1| hypothetical protein CARUB_v10017577mg [Caps... 63 9e-08 ref|XP_006280756.1| hypothetical protein CARUB_v10026723mg [Caps... 63 9e-08 ref|XP_004294576.1| PREDICTED: UDP-glucuronic acid decarboxylase... 63 9e-08 gb|EMJ06674.1| hypothetical protein PRUPE_ppa008066mg [Prunus pe... 63 9e-08 gb|AAT40108.1| putative UDP-glucuronate decarboxylase 2 [Nicotia... 63 9e-08 gb|ACJ54442.1| UDP-glucuronic acid decarboxylase 3 [Gossypium hi... 63 9e-08 ref|XP_003543505.1| PREDICTED: UDP-glucuronic acid decarboxylase... 63 9e-08 >gb|EXB52248.1| UDP-glucuronic acid decarboxylase 1 [Morus notabilis] Length = 346 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 199 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 228 >ref|NP_200737.1| UDP-glucuronic acid decarboxylase 3 [Arabidopsis thaliana] gi|75170812|sp|Q9FIE8.1|UXS3_ARATH RecName: Full=UDP-glucuronic acid decarboxylase 3; AltName: Full=UDP-XYL synthase 3; AltName: Full=UDP-glucuronate decarboxylase 3; Short=UGD; Short=UXS-3 gi|14595666|gb|AAK70882.1|AF387789_1 UDP-glucuronic acid decarboxylase [Arabidopsis thaliana] gi|9759250|dbj|BAB09774.1| dTDP-glucose 4-6-dehydratase [Arabidopsis thaliana] gi|21594196|gb|AAM65979.1| dTDP-glucose 4-6-dehydratase-like protein [Arabidopsis thaliana] gi|332009783|gb|AED97166.1| UDP-glucuronic acid decarboxylase 3 [Arabidopsis thaliana] Length = 342 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 196 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 225 >gb|ESW22302.1| hypothetical protein PHAVU_005G142500g [Phaseolus vulgaris] Length = 349 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 202 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 231 >ref|XP_006424785.1| hypothetical protein CICLE_v10028768mg [Citrus clementina] gi|567864274|ref|XP_006424786.1| hypothetical protein CICLE_v10028768mg [Citrus clementina] gi|568870182|ref|XP_006488286.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 [Citrus sinensis] gi|568870184|ref|XP_006488287.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 [Citrus sinensis] gi|568870186|ref|XP_006488288.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X3 [Citrus sinensis] gi|557526719|gb|ESR38025.1| hypothetical protein CICLE_v10028768mg [Citrus clementina] gi|557526720|gb|ESR38026.1| hypothetical protein CICLE_v10028768mg [Citrus clementina] Length = 343 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 196 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 225 >ref|XP_006409908.1| hypothetical protein EUTSA_v10016891mg [Eutrema salsugineum] gi|557111077|gb|ESQ51361.1| hypothetical protein EUTSA_v10016891mg [Eutrema salsugineum] Length = 339 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 193 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 222 >ref|XP_006400977.1| hypothetical protein EUTSA_v10014020mg [Eutrema salsugineum] gi|567177299|ref|XP_006400978.1| hypothetical protein EUTSA_v10014020mg [Eutrema salsugineum] gi|557102067|gb|ESQ42430.1| hypothetical protein EUTSA_v10014020mg [Eutrema salsugineum] gi|557102068|gb|ESQ42431.1| hypothetical protein EUTSA_v10014020mg [Eutrema salsugineum] Length = 342 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 196 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 225 >ref|XP_006418896.1| hypothetical protein EUTSA_v10002602mg [Eutrema salsugineum] gi|567159028|ref|XP_006418897.1| hypothetical protein EUTSA_v10002602mg [Eutrema salsugineum] gi|557096824|gb|ESQ37332.1| hypothetical protein EUTSA_v10002602mg [Eutrema salsugineum] gi|557096825|gb|ESQ37333.1| hypothetical protein EUTSA_v10002602mg [Eutrema salsugineum] Length = 341 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 195 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 224 >ref|XP_002298368.2| UDP-GLUCURONIC ACID DECARBOXYLASE family protein [Populus trichocarpa] gi|550348080|gb|EEE83173.2| UDP-GLUCURONIC ACID DECARBOXYLASE family protein [Populus trichocarpa] Length = 329 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 182 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 211 >ref|XP_006846098.1| hypothetical protein AMTR_s00012p00122270 [Amborella trichopoda] gi|548848868|gb|ERN07773.1| hypothetical protein AMTR_s00012p00122270 [Amborella trichopoda] Length = 346 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 200 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 229 >gb|EOY34100.1| UDP-XYL synthase 5 isoform 5 [Theobroma cacao] Length = 327 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 180 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 209 >gb|EOY34096.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao] gi|508786841|gb|EOY34097.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao] gi|508786842|gb|EOY34098.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao] gi|508786843|gb|EOY34099.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao] Length = 346 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 199 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 228 >gb|AGK44104.1| UDP-glucuronate decarboxylase protein 3 [Populus tomentosa] Length = 343 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 196 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 225 >ref|XP_006294492.1| hypothetical protein CARUB_v10023520mg, partial [Capsella rubella] gi|482563200|gb|EOA27390.1| hypothetical protein CARUB_v10023520mg, partial [Capsella rubella] Length = 353 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 207 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 236 >ref|XP_006291434.1| hypothetical protein CARUB_v10017577mg [Capsella rubella] gi|482560141|gb|EOA24332.1| hypothetical protein CARUB_v10017577mg [Capsella rubella] Length = 341 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 195 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 224 >ref|XP_006280756.1| hypothetical protein CARUB_v10026723mg [Capsella rubella] gi|482549460|gb|EOA13654.1| hypothetical protein CARUB_v10026723mg [Capsella rubella] Length = 342 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 196 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 225 >ref|XP_004294576.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Fragaria vesca subsp. vesca] Length = 346 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 199 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 228 >gb|EMJ06674.1| hypothetical protein PRUPE_ppa008066mg [Prunus persica] Length = 346 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 199 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 228 >gb|AAT40108.1| putative UDP-glucuronate decarboxylase 2 [Nicotiana tabacum] Length = 346 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 199 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 228 >gb|ACJ54442.1| UDP-glucuronic acid decarboxylase 3 [Gossypium hirsutum] Length = 345 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 199 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 228 >ref|XP_003543505.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Glycine max] Length = 348 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 90 RIARIFNTYGPRMNIDDGRVVSNFIAQALR Sbjct: 201 RIARIFNTYGPRMNIDDGRVVSNFIAQALR 230