BLASTX nr result
ID: Ephedra25_contig00025946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00025946 (708 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW07905.1| hypothetical protein 0_14083_01, partial [Pinus r... 80 5e-13 >gb|AEW07905.1| hypothetical protein 0_14083_01, partial [Pinus radiata] gi|383132654|gb|AFG47217.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132656|gb|AFG47218.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132658|gb|AFG47219.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132660|gb|AFG47220.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132662|gb|AFG47221.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132664|gb|AFG47222.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132666|gb|AFG47223.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132668|gb|AFG47224.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132670|gb|AFG47225.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132672|gb|AFG47226.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132674|gb|AFG47227.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132676|gb|AFG47228.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132678|gb|AFG47229.1| hypothetical protein 0_14083_01, partial [Pinus taeda] gi|383132680|gb|AFG47230.1| hypothetical protein 0_14083_01, partial [Pinus taeda] Length = 146 Score = 80.5 bits (197), Expect = 5e-13 Identities = 40/91 (43%), Positives = 61/91 (67%) Frame = +3 Query: 3 EMKEKKTKQVTISDVKGESVREFLWFLYRGELRETSSKDHVKDLLQLAHRFQVKGLVQML 182 ++KEK+T++V I +V GES++ FL FLY +L ++L++LAH +QVK L+ L Sbjct: 48 DLKEKETREVVIQEVGGESLKTFLKFLYTAQLNSEEMHAKYRELVKLAHFYQVKLLLMKL 107 Query: 183 DVFIHSEFVSSSCNWDLLKFAFIYDLPKTKE 275 D FI SE VS + ++LK A++YDL T+E Sbjct: 108 DNFISSEIVSKNACIEILKMAYLYDLETTRE 138