BLASTX nr result
ID: Ephedra25_contig00025926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00025926 (551 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006292415.1| hypothetical protein CARUB_v10018629mg [Caps... 56 5e-06 >ref|XP_006292415.1| hypothetical protein CARUB_v10018629mg [Capsella rubella] gi|482561122|gb|EOA25313.1| hypothetical protein CARUB_v10018629mg [Capsella rubella] Length = 355 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/59 (49%), Positives = 41/59 (69%) Frame = -2 Query: 322 LGALTLHSSMAATDVIPMTMDPINPKTHEMDKRRIRRPFTAIEAKALIHVVEKLGIGRY 146 +G++ + S+AA V+P+ M +P EM +RRIRRPFT E +AL+ VEKLGIGR+ Sbjct: 235 IGSVDSNCSVAAKSVVPVRMKHASPP--EMVQRRIRRPFTVSEVEALVQAVEKLGIGRW 291