BLASTX nr result
ID: Ephedra25_contig00025717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00025717 (549 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006390383.1| hypothetical protein EUTSA_v10018112mg [Eutr... 103 3e-20 ref|NP_177623.1| plastid transcriptionally active 2 [Arabidopsis... 103 3e-20 ref|XP_002888995.1| hypothetical protein ARALYDRAFT_476621 [Arab... 103 3e-20 ref|XP_006300609.1| hypothetical protein CARUB_v10019779mg [Caps... 101 1e-19 ref|XP_002511477.1| pentatricopeptide repeat-containing protein,... 100 2e-19 ref|XP_004301287.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 gb|EMJ11568.1| hypothetical protein PRUPE_ppa001337mg [Prunus pe... 100 2e-19 ref|XP_006476695.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_006439718.1| hypothetical protein CICLE_v10018817mg [Citr... 100 3e-19 gb|EXB29767.1| hypothetical protein L484_008930 [Morus notabilis] 100 4e-19 ref|XP_002280557.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 ref|XP_006600662.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 gb|ESW27367.1| hypothetical protein PHAVU_003G195800g [Phaseolus... 99 5e-19 ref|XP_003549648.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 ref|XP_006579551.1| PREDICTED: pentatricopeptide repeat-containi... 99 9e-19 ref|XP_006344988.1| PREDICTED: pentatricopeptide repeat-containi... 99 9e-19 gb|EOY20557.1| Plastid transcriptionally active 2 isoform 3 [The... 99 9e-19 gb|EOY20556.1| Plastid transcriptionally active 2 isoform 2 [The... 99 9e-19 gb|EOY20555.1| Plastid transcriptionally active 2 isoform 1 [The... 99 9e-19 ref|XP_004508810.1| PREDICTED: pentatricopeptide repeat-containi... 99 9e-19 >ref|XP_006390383.1| hypothetical protein EUTSA_v10018112mg [Eutrema salsugineum] gi|557086817|gb|ESQ27669.1| hypothetical protein EUTSA_v10018112mg [Eutrema salsugineum] Length = 863 Score = 103 bits (257), Expect = 3e-20 Identities = 47/73 (64%), Positives = 58/73 (79%) Frame = +2 Query: 329 SEEEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRAL 508 S E+GKYSY VE I + +L RGSI RCL+ FKNKL+LNDFAL+F++ G G+WQR+L Sbjct: 65 SVEKGKYSYDVESLINKLSSLPPRGSIARCLDIFKNKLSLNDFALVFKEFAGRGDWQRSL 124 Query: 509 KLFKYMQRQQWCK 547 +LFKYMQRQ WCK Sbjct: 125 RLFKYMQRQIWCK 137 >ref|NP_177623.1| plastid transcriptionally active 2 [Arabidopsis thaliana] gi|75194055|sp|Q9S7Q2.1|PP124_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g74850, chloroplastic; AltName: Full=Protein PLASTID TRANSCRIPTIONALLY ACTIVE 2; Flags: Precursor gi|5882738|gb|AAD55291.1|AC008263_22 Contains 3 PF|01535 DUF17 domains [Arabidopsis thaliana] gi|12323908|gb|AAG51934.1|AC013258_28 hypothetical protein; 81052-84129 [Arabidopsis thaliana] gi|332197518|gb|AEE35639.1| plastid transcriptionally active 2 [Arabidopsis thaliana] Length = 862 Score = 103 bits (257), Expect = 3e-20 Identities = 47/73 (64%), Positives = 58/73 (79%) Frame = +2 Query: 329 SEEEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRAL 508 S E+GKYSY VE I + +L RGSI RCL+ FKNKL+LNDFAL+F++ G G+WQR+L Sbjct: 66 SVEKGKYSYDVESLINKLSSLPPRGSIARCLDIFKNKLSLNDFALVFKEFAGRGDWQRSL 125 Query: 509 KLFKYMQRQQWCK 547 +LFKYMQRQ WCK Sbjct: 126 RLFKYMQRQIWCK 138 >ref|XP_002888995.1| hypothetical protein ARALYDRAFT_476621 [Arabidopsis lyrata subsp. lyrata] gi|297334836|gb|EFH65254.1| hypothetical protein ARALYDRAFT_476621 [Arabidopsis lyrata subsp. lyrata] Length = 863 Score = 103 bits (257), Expect = 3e-20 Identities = 47/73 (64%), Positives = 58/73 (79%) Frame = +2 Query: 329 SEEEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRAL 508 S E+GKYSY VE I + +L RGSI RCL+ FKNKL+LNDFAL+F++ G G+WQR+L Sbjct: 66 SVEKGKYSYDVESLINKLSSLPPRGSIARCLDIFKNKLSLNDFALVFKEFAGRGDWQRSL 125 Query: 509 KLFKYMQRQQWCK 547 +LFKYMQRQ WCK Sbjct: 126 RLFKYMQRQIWCK 138 >ref|XP_006300609.1| hypothetical protein CARUB_v10019779mg [Capsella rubella] gi|482569319|gb|EOA33507.1| hypothetical protein CARUB_v10019779mg [Capsella rubella] Length = 865 Score = 101 bits (251), Expect = 1e-19 Identities = 46/73 (63%), Positives = 57/73 (78%) Frame = +2 Query: 329 SEEEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRAL 508 S E+GKYSY VE I + +L RGSI RCL+ FKNKL+LNDFAL+F++ G +WQR+L Sbjct: 66 SVEKGKYSYDVESLINKLSSLPPRGSIARCLDIFKNKLSLNDFALVFKEFAGRSDWQRSL 125 Query: 509 KLFKYMQRQQWCK 547 +LFKYMQRQ WCK Sbjct: 126 RLFKYMQRQIWCK 138 >ref|XP_002511477.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550592|gb|EEF52079.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 754 Score = 100 bits (250), Expect = 2e-19 Identities = 46/71 (64%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCLE FKNKL+LNDFAL+F++ G+WQR+L+L Sbjct: 69 EKGKYSYDVETLINKLSSLPPRGSIARCLEIFKNKLSLNDFALVFKEFAQRGDWQRSLRL 128 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 129 FKYMQRQIWCK 139 >ref|XP_004301287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 862 Score = 100 bits (249), Expect = 2e-19 Identities = 45/71 (63%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCL+ FKNKL+LNDFAL+F++ G+WQR+L+L Sbjct: 65 EKGKYSYDVETLINKLSSLPPRGSIARCLDIFKNKLSLNDFALVFKEFAARGDWQRSLRL 124 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 125 FKYMQRQIWCK 135 >gb|EMJ11568.1| hypothetical protein PRUPE_ppa001337mg [Prunus persica] Length = 850 Score = 100 bits (249), Expect = 2e-19 Identities = 45/71 (63%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCL+ FKNKL+LNDFAL+F++ G+WQR+L+L Sbjct: 53 EKGKYSYDVETLINKLSSLPPRGSIARCLDIFKNKLSLNDFALVFKEFAARGDWQRSLRL 112 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 113 FKYMQRQIWCK 123 >ref|XP_006476695.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like [Citrus sinensis] Length = 871 Score = 100 bits (248), Expect = 3e-19 Identities = 45/71 (63%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCL+ FKNKL+LNDFAL+F++ G+WQR+L+L Sbjct: 74 EKGKYSYDVETLINKLSSLPPRGSIARCLDMFKNKLSLNDFALVFKEFAQRGDWQRSLRL 133 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 134 FKYMQRQIWCK 144 >ref|XP_006439718.1| hypothetical protein CICLE_v10018817mg [Citrus clementina] gi|557541980|gb|ESR52958.1| hypothetical protein CICLE_v10018817mg [Citrus clementina] Length = 871 Score = 100 bits (248), Expect = 3e-19 Identities = 45/71 (63%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCL+ FKNKL+LNDFAL+F++ G+WQR+L+L Sbjct: 74 EKGKYSYDVETLINKLSSLPPRGSIARCLDMFKNKLSLNDFALVFKEFAQRGDWQRSLRL 133 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 134 FKYMQRQIWCK 144 >gb|EXB29767.1| hypothetical protein L484_008930 [Morus notabilis] Length = 905 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/71 (63%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCL+ FKNKL+LNDFAL+F++ G+WQR+L+L Sbjct: 85 EKGKYSYDVETLINKLSSLPPRGSIARCLDIFKNKLSLNDFALVFKEFAQRGDWQRSLRL 144 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 145 FKYMQRQIWCK 155 >ref|XP_002280557.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic [Vitis vinifera] Length = 869 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/71 (63%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCL+ FKNKL+LNDFAL+F++ G+WQR+L+L Sbjct: 73 EKGKYSYDVETLINKLSSLPPRGSIARCLDVFKNKLSLNDFALVFKEFAQRGDWQRSLRL 132 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 133 FKYMQRQIWCK 143 >ref|XP_006600662.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like isoform X2 [Glycine max] Length = 860 Score = 99.4 bits (246), Expect = 5e-19 Identities = 46/71 (64%), Positives = 55/71 (77%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I I L RGSI RCL+ FKNKL+LNDFAL+F++ G+WQR+L+L Sbjct: 63 EKGKYSYDVETLINRITALPPRGSIARCLDPFKNKLSLNDFALVFKEFAQRGDWQRSLRL 122 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 123 FKYMQRQIWCK 133 >gb|ESW27367.1| hypothetical protein PHAVU_003G195800g [Phaseolus vulgaris] Length = 857 Score = 99.4 bits (246), Expect = 5e-19 Identities = 48/85 (56%), Positives = 61/85 (71%) Frame = +2 Query: 293 FRAQATVETSLTSEEEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFR 472 F+ + S+T E+ GKYSY VE I + L RGSI RCL+ FKNKL+LNDFAL+F+ Sbjct: 50 FKELIPINPSVTVEK-GKYSYDVETLINRLTALPPRGSIARCLDPFKNKLSLNDFALVFK 108 Query: 473 DLGGCGEWQRALKLFKYMQRQQWCK 547 + G+WQR+L+LFKYMQRQ WCK Sbjct: 109 EFAQRGDWQRSLRLFKYMQRQLWCK 133 >ref|XP_003549648.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like isoform X1 [Glycine max] Length = 859 Score = 99.4 bits (246), Expect = 5e-19 Identities = 46/71 (64%), Positives = 55/71 (77%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I I L RGSI RCL+ FKNKL+LNDFAL+F++ G+WQR+L+L Sbjct: 63 EKGKYSYDVETLINRITALPPRGSIARCLDPFKNKLSLNDFALVFKEFAQRGDWQRSLRL 122 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 123 FKYMQRQIWCK 133 >ref|XP_006579551.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like isoform X2 [Glycine max] Length = 858 Score = 98.6 bits (244), Expect = 9e-19 Identities = 45/71 (63%), Positives = 55/71 (77%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + L RGSI RCL+ FKNKL+LNDFAL+F++ G+WQR+L+L Sbjct: 61 EKGKYSYDVETLINRLTALPPRGSIARCLDPFKNKLSLNDFALVFKEFAQRGDWQRSLRL 120 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 121 FKYMQRQIWCK 131 >ref|XP_006344988.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like [Solanum tuberosum] Length = 860 Score = 98.6 bits (244), Expect = 9e-19 Identities = 43/71 (60%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCL+ FKNKL+L+DF+L+F++ G+WQR+L+L Sbjct: 63 EKGKYSYDVETLINKLSSLPPRGSIARCLDTFKNKLSLSDFSLVFKEFAARGDWQRSLRL 122 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 123 FKYMQRQIWCK 133 >gb|EOY20557.1| Plastid transcriptionally active 2 isoform 3 [Theobroma cacao] Length = 811 Score = 98.6 bits (244), Expect = 9e-19 Identities = 44/71 (61%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCL+ F+NKL+LNDFAL+F++ G+WQR+L+L Sbjct: 63 EKGKYSYDVETLINKLSSLPPRGSIARCLDVFRNKLSLNDFALVFKEFAHRGDWQRSLRL 122 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 123 FKYMQRQIWCK 133 >gb|EOY20556.1| Plastid transcriptionally active 2 isoform 2 [Theobroma cacao] Length = 770 Score = 98.6 bits (244), Expect = 9e-19 Identities = 44/71 (61%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCL+ F+NKL+LNDFAL+F++ G+WQR+L+L Sbjct: 63 EKGKYSYDVETLINKLSSLPPRGSIARCLDVFRNKLSLNDFALVFKEFAHRGDWQRSLRL 122 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 123 FKYMQRQIWCK 133 >gb|EOY20555.1| Plastid transcriptionally active 2 isoform 1 [Theobroma cacao] Length = 859 Score = 98.6 bits (244), Expect = 9e-19 Identities = 44/71 (61%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E+GKYSY VE I + +L RGSI RCL+ F+NKL+LNDFAL+F++ G+WQR+L+L Sbjct: 63 EKGKYSYDVETLINKLSSLPPRGSIARCLDVFRNKLSLNDFALVFKEFAHRGDWQRSLRL 122 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 123 FKYMQRQIWCK 133 >ref|XP_004508810.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic-like [Cicer arietinum] Length = 861 Score = 98.6 bits (244), Expect = 9e-19 Identities = 43/71 (60%), Positives = 56/71 (78%) Frame = +2 Query: 335 EEGKYSYYVERAIANIKNLSSRGSITRCLENFKNKLNLNDFALIFRDLGGCGEWQRALKL 514 E GKYSY VE I + +L RGSI RCL++FKNKL+LNDF+++F++ G+WQR+L+L Sbjct: 65 ESGKYSYDVETLINRLSSLPPRGSIARCLDSFKNKLSLNDFSVVFKEFAQRGDWQRSLRL 124 Query: 515 FKYMQRQQWCK 547 FKYMQRQ WCK Sbjct: 125 FKYMQRQIWCK 135