BLASTX nr result
ID: Ephedra25_contig00025592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00025592 (658 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001639462.1| predicted protein [Nematostella vectensis] g... 50 1e-09 >ref|XP_001639462.1| predicted protein [Nematostella vectensis] gi|156226591|gb|EDO47399.1| predicted protein [Nematostella vectensis] Length = 974 Score = 49.7 bits (117), Expect(3) = 1e-09 Identities = 24/46 (52%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = +3 Query: 162 RVISKVWELVSR-FDDGMKKKFLKFVTGSSKAPFLGVEHLKPSFTI 296 RV+ +WE++ + F+D K FLKFVT SK P LG EHL+P F+I Sbjct: 854 RVVVWLWEILDKEFNDQEKSLFLKFVTSCSKPPLLGFEHLEPPFSI 899 Score = 29.6 bits (65), Expect(3) = 1e-09 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +2 Query: 323 LPVSSASVNLLKLPTY*SKDVLQTKL 400 LP +S NLLKLP Y K L+ KL Sbjct: 936 LPTASTCFNLLKLPNYRKKSTLRDKL 961 Score = 28.9 bits (63), Expect(3) = 1e-09 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 23 FKVMKHKHFTT-FNEEELQIIISCSNSRIQVTDLQASTKYNG 145 FK + H + F+ ELQ +IS N+ + ++DL+ T+Y G Sbjct: 806 FKSIVHNDWLRMFSAPELQRLISGDNTALDLSDLRVHTRYYG 847