BLASTX nr result
ID: Ephedra25_contig00023681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00023681 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW83426.1| hypothetical protein ZEAMMB73_660957 [Zea mays] 56 6e-06 gb|AFW83425.1| potassium channel [Zea mays] 56 6e-06 >gb|AFW83426.1| hypothetical protein ZEAMMB73_660957 [Zea mays] Length = 913 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 4 DLLFKGAQIFGFKPTRILTTGYAEIDDIHLIRDGDH 111 +LL GA+ FGFKPT++LTTG AEID++ LIRDGDH Sbjct: 858 ELLELGARKFGFKPTKVLTTGGAEIDEVELIRDGDH 893 >gb|AFW83425.1| potassium channel [Zea mays] Length = 887 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 4 DLLFKGAQIFGFKPTRILTTGYAEIDDIHLIRDGDH 111 +LL GA+ FGFKPT++LTTG AEID++ LIRDGDH Sbjct: 832 ELLELGARKFGFKPTKVLTTGGAEIDEVELIRDGDH 867