BLASTX nr result
ID: Ephedra25_contig00023535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00023535 (613 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853704.1| hypothetical protein AMTR_s00056p00146390 [A... 61 3e-07 >ref|XP_006853704.1| hypothetical protein AMTR_s00056p00146390 [Amborella trichopoda] gi|548857365|gb|ERN15171.1| hypothetical protein AMTR_s00056p00146390 [Amborella trichopoda] Length = 1015 Score = 60.8 bits (146), Expect = 3e-07 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 1/82 (1%) Frame = +2 Query: 2 LSRLHRLERLSIVDCPKLQKVSNLPTHLHSVEITNCESLKVI-DVRDLQSLKDFQVRSCT 178 LS+L L RL +VDC +L + LPT L +++ +NC SL++I ++ L LK +R+C Sbjct: 906 LSQLSELGRLDVVDCGELSAIQELPTALETLDASNCISLQIIPNLSHLSQLKKLDLRNCK 965 Query: 179 RLRNIMGLIRLDGISSLDIQEC 244 +L I GL L + LD+ C Sbjct: 966 KLIEIQGLSGLISLRYLDLTGC 987