BLASTX nr result
ID: Ephedra25_contig00022772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00022772 (455 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG65671.1| hypothetical protein 2_6183_01, partial [Pinus ta... 55 7e-06 gb|AEW08311.1| hypothetical protein 2_6183_01, partial [Pinus ra... 55 7e-06 >gb|AFG65671.1| hypothetical protein 2_6183_01, partial [Pinus taeda] Length = 140 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = -2 Query: 454 LALLCTQGDSSLRPPMSEVLLMLSSHVDVSKLANPTTPDYLNFSCSESSSST 299 + LLCTQ DSSLRPPMS V+LMLSSH L +P P ++N S++S ST Sbjct: 52 VGLLCTQSDSSLRPPMSTVILMLSSH--SVTLPDPKKPAFMNSRASQNSKST 101 >gb|AEW08311.1| hypothetical protein 2_6183_01, partial [Pinus radiata] gi|383165565|gb|AFG65666.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165567|gb|AFG65667.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165569|gb|AFG65668.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165571|gb|AFG65669.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165573|gb|AFG65670.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165577|gb|AFG65672.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165579|gb|AFG65673.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165581|gb|AFG65674.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165583|gb|AFG65675.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165585|gb|AFG65676.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165587|gb|AFG65677.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165589|gb|AFG65678.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165591|gb|AFG65679.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165593|gb|AFG65680.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165595|gb|AFG65681.1| hypothetical protein 2_6183_01, partial [Pinus taeda] gi|383165597|gb|AFG65682.1| hypothetical protein 2_6183_01, partial [Pinus taeda] Length = 140 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = -2 Query: 454 LALLCTQGDSSLRPPMSEVLLMLSSHVDVSKLANPTTPDYLNFSCSESSSST 299 + LLCTQ DSSLRPPMS V+LMLSSH L +P P ++N S++S ST Sbjct: 52 VGLLCTQSDSSLRPPMSTVILMLSSH--SVTLPDPKKPAFMNSRASQNSKST 101