BLASTX nr result
ID: Ephedra25_contig00022582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00022582 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY27823.1| Pentatricopeptide repeat (PPR) superfamily protei... 100 2e-19 ref|XP_004504222.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 emb|CBI20738.3| unnamed protein product [Vitis vinifera] 100 3e-19 emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] 100 3e-19 gb|ESW31536.1| hypothetical protein PHAVU_002G246300g [Phaseolus... 100 3e-19 ref|XP_003532785.1| PREDICTED: pentatricopeptide repeat-containi... 99 6e-19 ref|XP_002316137.1| pentatricopeptide repeat-containing family p... 99 8e-19 ref|XP_004501417.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 98 1e-18 ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_002867196.1| pentatricopeptide repeat-containing protein ... 98 1e-18 ref|XP_006581311.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_006578098.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 gb|ESW33636.1| hypothetical protein PHAVU_001G086300g [Phaseolus... 98 1e-18 ref|XP_006599001.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 gb|EOX98248.1| Tetratricopeptide repeat-like superfamily protein... 97 2e-18 ref|XP_006285430.1| hypothetical protein CARUB_v10006847mg [Caps... 97 2e-18 ref|XP_003629914.1| Pentatricopeptide repeat-containing protein ... 97 2e-18 ref|XP_006650653.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 >gb|EOY27823.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 717 Score = 100 bits (250), Expect = 2e-19 Identities = 47/71 (66%), Positives = 57/71 (80%) Frame = +1 Query: 58 YHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHHF 237 YHSE LAIAFGL++T S I+V++N + G CHSAIKLI+ +V R+IVVRDS RFHHF Sbjct: 648 YHSERLAIAFGLVTTAGG-SAITVMKNLRVCGDCHSAIKLIAKIVGREIVVRDSTRFHHF 706 Query: 238 KEGVCSCGDYW 270 K G+CSCGDYW Sbjct: 707 KNGICSCGDYW 717 >ref|XP_004504222.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial-like [Cicer arietinum] Length = 708 Score = 100 bits (248), Expect = 3e-19 Identities = 46/71 (64%), Positives = 57/71 (80%) Frame = +1 Query: 58 YHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHHF 237 YHSE LAIAFGL+ST S I+V++N + G CH+ IKL++ +VDR+IVVRDS RFHHF Sbjct: 639 YHSERLAIAFGLLSTVEG-SRITVMKNLRVCGDCHNVIKLLAKIVDREIVVRDSSRFHHF 697 Query: 238 KEGVCSCGDYW 270 K G+CSCGDYW Sbjct: 698 KNGICSCGDYW 708 >ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 1580 Score = 100 bits (248), Expect = 3e-19 Identities = 45/72 (62%), Positives = 60/72 (83%) Frame = +1 Query: 55 FYHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHH 234 +YHSE+LAIA+GL+STP S + I V++N + G CH+AIK IS V +R+IV+RD+ RFHH Sbjct: 1510 YYHSEKLAIAYGLISTPASTT-IRVIKNLRVCGDCHNAIKYISKVFEREIVLRDANRFHH 1568 Query: 235 FKEGVCSCGDYW 270 F++GVCSCGDYW Sbjct: 1569 FRDGVCSCGDYW 1580 >emb|CBI20738.3| unnamed protein product [Vitis vinifera] Length = 865 Score = 100 bits (248), Expect = 3e-19 Identities = 45/72 (62%), Positives = 60/72 (83%) Frame = +1 Query: 55 FYHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHH 234 +YHSE+LAIA+GL+STP S + I V++N + G CH+AIK IS V +R+IV+RD+ RFHH Sbjct: 795 YYHSEKLAIAYGLISTPASTT-IRVIKNLRVCGDCHNAIKYISKVFEREIVLRDANRFHH 853 Query: 235 FKEGVCSCGDYW 270 F++GVCSCGDYW Sbjct: 854 FRDGVCSCGDYW 865 >emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] Length = 503 Score = 100 bits (248), Expect = 3e-19 Identities = 45/72 (62%), Positives = 60/72 (83%) Frame = +1 Query: 55 FYHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHH 234 +YHSE+LAIA+GL+STP S + I V++N + G CH+AIK IS V +R+IV+RD+ RFHH Sbjct: 433 YYHSEKLAIAYGLISTPASTT-IRVIKNLRVCGDCHNAIKYISKVFEREIVLRDANRFHH 491 Query: 235 FKEGVCSCGDYW 270 F++GVCSCGDYW Sbjct: 492 FRDGVCSCGDYW 503 >gb|ESW31536.1| hypothetical protein PHAVU_002G246300g [Phaseolus vulgaris] Length = 708 Score = 99.8 bits (247), Expect = 3e-19 Identities = 46/71 (64%), Positives = 58/71 (81%) Frame = +1 Query: 58 YHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHHF 237 YHSE LAIAFGL+ST S I+V++N + G CH+AIKL++++V R+IVVRDS RFHHF Sbjct: 639 YHSERLAIAFGLLSTVEG-STITVMKNLRVCGDCHTAIKLMANIVHREIVVRDSSRFHHF 697 Query: 238 KEGVCSCGDYW 270 K G+CSCGDYW Sbjct: 698 KNGICSCGDYW 708 >ref|XP_003532785.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial-like [Glycine max] Length = 721 Score = 99.0 bits (245), Expect = 6e-19 Identities = 46/71 (64%), Positives = 57/71 (80%) Frame = +1 Query: 58 YHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHHF 237 YHSE LAIAFGL+ST S I+V++N + G CH+AIKL++ +VDR+IVVRDS RFH F Sbjct: 652 YHSERLAIAFGLLSTVEG-SAITVMKNLRVCGDCHNAIKLMAKIVDREIVVRDSSRFHDF 710 Query: 238 KEGVCSCGDYW 270 K G+CSCGDYW Sbjct: 711 KNGICSCGDYW 721 >ref|XP_002316137.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222865177|gb|EEF02308.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 601 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/71 (61%), Positives = 58/71 (81%) Frame = +1 Query: 58 YHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHHF 237 YHSE+LAI+FGL++TP + I V++N + G CHSA KLISS++DR+I++RD RFHHF Sbjct: 532 YHSEKLAISFGLLNTPPGTT-IRVVKNLRVCGDCHSAAKLISSLIDREIILRDVQRFHHF 590 Query: 238 KEGVCSCGDYW 270 K+G CSCGDYW Sbjct: 591 KDGKCSCGDYW 601 >ref|XP_004501417.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like isoform X1 [Cicer arietinum] gi|502132556|ref|XP_004501418.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like isoform X2 [Cicer arietinum] Length = 992 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/72 (61%), Positives = 57/72 (79%) Frame = +1 Query: 55 FYHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHH 234 +YHSE+LAIA+GLM TP S + + V++N + G CH+AIK IS V R+IV+RD+ RFHH Sbjct: 922 YYHSEKLAIAYGLMKTPPSTT-LRVIKNLRVCGDCHNAIKYISKVFQREIVLRDANRFHH 980 Query: 235 FKEGVCSCGDYW 270 FK G+CSCGDYW Sbjct: 981 FKSGICSCGDYW 992 >ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/72 (62%), Positives = 57/72 (79%) Frame = +1 Query: 55 FYHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHH 234 +YHSE+LAIAFGL+STP S + I V++N + G CHSAIK IS + R+IV+RD+ RFHH Sbjct: 1503 YYHSEKLAIAFGLISTPPSAT-IRVIKNLRVCGDCHSAIKCISKLTQREIVLRDANRFHH 1561 Query: 235 FKEGVCSCGDYW 270 F+ G CSCGDYW Sbjct: 1562 FRNGTCSCGDYW 1573 >ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/72 (62%), Positives = 57/72 (79%) Frame = +1 Query: 55 FYHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHH 234 +YHSE+LAIAFGL+STP S + I V++N + G CHSAIK IS + R+IV+RD+ RFHH Sbjct: 1503 YYHSEKLAIAFGLISTPPSAT-IRVIKNLRVCGDCHSAIKCISKLTQREIVLRDANRFHH 1561 Query: 235 FKEGVCSCGDYW 270 F+ G CSCGDYW Sbjct: 1562 FRNGTCSCGDYW 1573 >ref|XP_002867196.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313032|gb|EFH43455.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 997 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/72 (61%), Positives = 58/72 (80%) Frame = +1 Query: 55 FYHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHH 234 +YHSE+LA+AFGL+STP S I V++N + G CH+A+K IS V DR+IV+RD+ RFH Sbjct: 927 YYHSEKLAVAFGLLSTPPSTP-IRVIKNLRVCGDCHNAMKYISKVYDREIVLRDANRFHR 985 Query: 235 FKEGVCSCGDYW 270 FK+G+CSCGDYW Sbjct: 986 FKDGICSCGDYW 997 >ref|XP_006581311.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 981 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/72 (59%), Positives = 58/72 (80%) Frame = +1 Query: 55 FYHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHH 234 +YHSE+LAIA+GLM TP S + + V++N + G CH+AIK IS V +R++V+RD+ RFHH Sbjct: 911 YYHSEKLAIAYGLMKTPPSTT-LRVIKNLRVCGDCHNAIKYISKVFEREVVLRDANRFHH 969 Query: 235 FKEGVCSCGDYW 270 F+ GVCSCGDYW Sbjct: 970 FRSGVCSCGDYW 981 >ref|XP_006578098.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 980 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/72 (61%), Positives = 57/72 (79%) Frame = +1 Query: 55 FYHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHH 234 +YHSE+LAIA+GLM TP S + + V++N + G CHSAIK IS V R+IV+RD+ RFHH Sbjct: 910 YYHSEKLAIAYGLMKTPPSTT-LRVIKNLRVCGDCHSAIKYISKVFKREIVLRDANRFHH 968 Query: 235 FKEGVCSCGDYW 270 F+ G+CSCGDYW Sbjct: 969 FRNGICSCGDYW 980 >gb|ESW33636.1| hypothetical protein PHAVU_001G086300g [Phaseolus vulgaris] Length = 669 Score = 97.8 bits (242), Expect = 1e-18 Identities = 52/91 (57%), Positives = 64/91 (70%), Gaps = 1/91 (1%) Frame = +1 Query: 1 YLTSCRGMLSYEHDGGGPFYHSEELAIAFGLM-STPTSISCISVLQNHLMSGPCHSAIKL 177 YLTS + E G HSE+LA+ FG+M S P SI I +++N + G CH AIKL Sbjct: 581 YLTSVLHDVDEEEKGMVLRVHSEKLAVCFGIMNSVPGSI--IHIIKNLRICGDCHIAIKL 638 Query: 178 ISSVVDRQIVVRDSWRFHHFKEGVCSCGDYW 270 IS VV+R+IVVRDS RFHHFK+G+CSCGDYW Sbjct: 639 ISKVVNREIVVRDSKRFHHFKDGMCSCGDYW 669 >ref|XP_006599001.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Glycine max] Length = 653 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/71 (66%), Positives = 58/71 (81%), Gaps = 1/71 (1%) Frame = +1 Query: 61 HSEELAIAFGLM-STPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHHF 237 HSE+LA+AFG+M S P SI I +++N + G CHSAIKLIS V+R+IVVRDS RFHHF Sbjct: 585 HSEKLAVAFGIMNSVPGSI--IQIIKNLRICGDCHSAIKLISKAVNREIVVRDSKRFHHF 642 Query: 238 KEGVCSCGDYW 270 K+G+CSCGDYW Sbjct: 643 KDGLCSCGDYW 653 >gb|EOX98248.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 613 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/71 (57%), Positives = 57/71 (80%) Frame = +1 Query: 58 YHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHHF 237 YHSE LAIAFGL+STP + +++N + G CH+AIK+IS +V R++++RD+ RFHHF Sbjct: 544 YHSERLAIAFGLISTPAR-QTLRIIKNLRVCGDCHNAIKIISRIVGRELIIRDNKRFHHF 602 Query: 238 KEGVCSCGDYW 270 K+G+CSCGDYW Sbjct: 603 KDGLCSCGDYW 613 >ref|XP_006285430.1| hypothetical protein CARUB_v10006847mg [Capsella rubella] gi|482554135|gb|EOA18328.1| hypothetical protein CARUB_v10006847mg [Capsella rubella] Length = 996 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/72 (61%), Positives = 57/72 (79%) Frame = +1 Query: 55 FYHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHH 234 +YHSE+LA+AFGLMSTP S I V++N + G CH+A+K I+ V DR+IV+RD+ RFH Sbjct: 926 YYHSEKLAVAFGLMSTPPSTP-IRVIKNLRICGDCHNAMKYIAKVYDREIVLRDANRFHR 984 Query: 235 FKEGVCSCGDYW 270 FK G+CSCGDYW Sbjct: 985 FKNGICSCGDYW 996 >ref|XP_003629914.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523936|gb|AET04390.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 727 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/71 (61%), Positives = 57/71 (80%) Frame = +1 Query: 58 YHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHHF 237 YHSE LAIAFGL+ST S I++++N + G CH+AI L++ +V+R+IVVRDS RFHHF Sbjct: 658 YHSERLAIAFGLLSTVEG-STITIMKNLRVCGDCHTAITLMAKIVNREIVVRDSSRFHHF 716 Query: 238 KEGVCSCGDYW 270 K G+CSCGDYW Sbjct: 717 KNGICSCGDYW 727 >ref|XP_006650653.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Oryza brachyantha] Length = 297 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/71 (61%), Positives = 55/71 (77%) Frame = +1 Query: 58 YHSEELAIAFGLMSTPTSISCISVLQNHLMSGPCHSAIKLISSVVDRQIVVRDSWRFHHF 237 YHSE LAIAFGL+STP + V++N + G CH+A+KLI+ V R+IVVRD+ RFHHF Sbjct: 228 YHSERLAIAFGLVSTPPGTP-LRVIKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHF 286 Query: 238 KEGVCSCGDYW 270 K+G CSCGDYW Sbjct: 287 KDGACSCGDYW 297