BLASTX nr result
ID: Ephedra25_contig00021689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00021689 (1456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858410.1| hypothetical protein AMTR_s00071p00045940 [A... 60 3e-06 >ref|XP_006858410.1| hypothetical protein AMTR_s00071p00045940 [Amborella trichopoda] gi|548862519|gb|ERN19877.1| hypothetical protein AMTR_s00071p00045940 [Amborella trichopoda] Length = 1080 Score = 59.7 bits (143), Expect = 3e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 417 LEVAVETIRSCLEKLSGLPKAQFDFLTFDSSLHYYNTKVRL 539 LEVA +TI+SCL+KL G P+ Q FLTFDSSLH+YN K L Sbjct: 503 LEVAAKTIKSCLDKLPGFPRTQIGFLTFDSSLHFYNMKSSL 543