BLASTX nr result
ID: Ephedra25_contig00021267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00021267 (857 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527747.1| monovalent cation:proton antiporter, putativ... 60 1e-06 emb|CBI30584.3| unnamed protein product [Vitis vinifera] 58 4e-06 ref|XP_002269591.1| PREDICTED: cation/H(+) antiporter 20-like [V... 58 4e-06 emb|CAN63422.1| hypothetical protein VITISV_023524 [Vitis vinifera] 58 4e-06 ref|XP_006480781.1| PREDICTED: cation/H(+) antiporter 20-like [C... 58 5e-06 ref|XP_006429040.1| hypothetical protein CICLE_v10011060mg [Citr... 58 5e-06 gb|EXC31015.1| Cation/H(+) antiporter 20 [Morus notabilis] 57 7e-06 ref|XP_002308966.2| hypothetical protein POPTR_0006s05340g [Popu... 57 7e-06 ref|XP_003625495.1| K(+)/H(+) antiporter [Medicago truncatula] g... 57 7e-06 >ref|XP_002527747.1| monovalent cation:proton antiporter, putative [Ricinus communis] gi|223532888|gb|EEF34660.1| monovalent cation:proton antiporter, putative [Ricinus communis] Length = 847 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -1 Query: 596 ESILEIARASKYDLLLVGRGRFSITLIADLADRPAEFPELGPIHDLLVS 450 E +L I R+ +DL++VG+GRF T++A+LAD PAE ELGPI D+L S Sbjct: 748 EGVLAIGRSGDHDLIVVGKGRFPSTMVAELADHPAEHAELGPIGDVLAS 796 >emb|CBI30584.3| unnamed protein product [Vitis vinifera] Length = 858 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = -1 Query: 596 ESILEIARASKYDLLLVGRGRFSITLIADLADRPAEFPELGPIHDLLVS 450 E +L I ++ YDL++VG+GRF T++A+LA+R AE ELGPI D+L S Sbjct: 757 EGVLAIGKSGDYDLVVVGKGRFPSTMVAELAERQAEHAELGPIGDILAS 805 >ref|XP_002269591.1| PREDICTED: cation/H(+) antiporter 20-like [Vitis vinifera] Length = 839 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = -1 Query: 596 ESILEIARASKYDLLLVGRGRFSITLIADLADRPAEFPELGPIHDLLVS 450 E +L I ++ YDL++VG+GRF T++A+LA+R AE ELGPI D+L S Sbjct: 738 EGVLAIGKSGDYDLVVVGKGRFPSTMVAELAERQAEHAELGPIGDILAS 786 >emb|CAN63422.1| hypothetical protein VITISV_023524 [Vitis vinifera] Length = 859 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = -1 Query: 596 ESILEIARASKYDLLLVGRGRFSITLIADLADRPAEFPELGPIHDLLVS 450 E +L I ++ YDL++VG+GRF T++A+LA+R AE ELGPI D+L S Sbjct: 758 EGVLAIGKSGDYDLVVVGKGRFPSTMVAELAERQAEHAELGPIGDILAS 806 >ref|XP_006480781.1| PREDICTED: cation/H(+) antiporter 20-like [Citrus sinensis] Length = 842 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -1 Query: 596 ESILEIARASKYDLLLVGRGRFSITLIADLADRPAEFPELGPIHDLLVS 450 E +L + R+ YDL++VG+GRF +IA LADR AE ELGPI D+L S Sbjct: 743 EGVLTLGRSGDYDLIIVGKGRFPSKMIAKLADRQAEHAELGPIGDILAS 791 >ref|XP_006429040.1| hypothetical protein CICLE_v10011060mg [Citrus clementina] gi|557531097|gb|ESR42280.1| hypothetical protein CICLE_v10011060mg [Citrus clementina] Length = 842 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -1 Query: 596 ESILEIARASKYDLLLVGRGRFSITLIADLADRPAEFPELGPIHDLLVS 450 E +L + R+ YDL++VG+GRF +IA LADR AE ELGPI D+L S Sbjct: 743 EGVLTLGRSGDYDLIIVGKGRFPSKMIAKLADRQAEHAELGPIGDILAS 791 >gb|EXC31015.1| Cation/H(+) antiporter 20 [Morus notabilis] Length = 858 Score = 57.4 bits (137), Expect = 7e-06 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -1 Query: 596 ESILEIARASKYDLLLVGRGRFSITLIADLADRPAEFPELGPIHDLLVS 450 E +L I +YDL++VG+GRF ++A+LA+R AE PELGPI D+L S Sbjct: 750 EGVLAIGCRGEYDLIVVGKGRFPSKMVAELAERQAEHPELGPIGDILAS 798 >ref|XP_002308966.2| hypothetical protein POPTR_0006s05340g [Populus trichocarpa] gi|550335516|gb|EEE92489.2| hypothetical protein POPTR_0006s05340g [Populus trichocarpa] Length = 841 Score = 57.4 bits (137), Expect = 7e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -1 Query: 596 ESILEIARASKYDLLLVGRGRFSITLIADLADRPAEFPELGPIHDLLVS 450 E +L I R+ YDL+ VG+GRF T+IA+LA R AE ELGPI D+L S Sbjct: 742 ERVLAIGRSGDYDLIFVGKGRFPSTMIAELAYRQAEHAELGPIGDILAS 790 >ref|XP_003625495.1| K(+)/H(+) antiporter [Medicago truncatula] gi|87240332|gb|ABD32190.1| Sodium/hydrogen exchanger [Medicago truncatula] gi|355500510|gb|AES81713.1| K(+)/H(+) antiporter [Medicago truncatula] Length = 851 Score = 57.4 bits (137), Expect = 7e-06 Identities = 28/78 (35%), Positives = 49/78 (62%) Frame = -1 Query: 596 ESILEIARASKYDLLLVGRGRFSITLIADLADRPAEFPELGPIHDLLVSLTLQTPNTAGY 417 E ++ + ++ YDL++VG+GRF T++A+LA+R AE ELGPI D+L S + G+ Sbjct: 751 EEVIALGESADYDLIVVGKGRFPSTMVAELAEREAEHAELGPIGDILTS-------SMGH 803 Query: 416 TSKTSARALKEGEQRVTE 363 +S +++ + +TE Sbjct: 804 KMASSVFVIQQHDVALTE 821