BLASTX nr result
ID: Ephedra25_contig00020351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00020351 (481 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003376808.1| retrovirus-related Pol polyprotein from tran... 55 7e-06 >ref|XP_003376808.1| retrovirus-related Pol polyprotein from transposon TNT 1-94 [Trichinella spiralis] gi|316974460|gb|EFV57947.1| retrovirus-related Pol polyprotein from transposon TNT 1-94 [Trichinella spiralis] Length = 1324 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/43 (51%), Positives = 33/43 (76%) Frame = +1 Query: 1 DPKAKRGIMVGYSETSKGYKIIDEETKKVIISQDVEFIEDNIP 129 DPK++ I VGY ETSKGY+ +D +TKK+ +++DV+F+E P Sbjct: 669 DPKSEERIFVGYCETSKGYRTVDRKTKKMYVTRDVKFLESQFP 711