BLASTX nr result
ID: Ephedra25_contig00018454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00018454 (550 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001784993.1| predicted protein [Physcomitrella patens] gi... 56 5e-06 ref|XP_001770107.1| predicted protein [Physcomitrella patens] gi... 55 9e-06 >ref|XP_001784993.1| predicted protein [Physcomitrella patens] gi|162663451|gb|EDQ50214.1| predicted protein [Physcomitrella patens] Length = 324 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = -2 Query: 546 EVSSTITCCDCRHSSVVFESYLDLSLPIPSRPNHQKSMASLEASIVSANSGKKQ 385 + SST+TCC+C HSSVV+E +LDLSLPIPS+ + K+ A + GKK+ Sbjct: 141 QYSSTVTCCECGHSSVVYEPFLDLSLPIPSKQSFGKT-----AEPIGEEIGKKK 189 >ref|XP_001770107.1| predicted protein [Physcomitrella patens] gi|162678633|gb|EDQ65089.1| predicted protein [Physcomitrella patens] Length = 334 Score = 55.5 bits (132), Expect = 9e-06 Identities = 27/63 (42%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = -2 Query: 546 EVSSTITCCDCRHSSVVFESYLDLSLPIPSRPNHQKSMASLEASIVSANS--GKKQESES 373 + SST+TCC+C HSSVV+E +LDLSLPIPS+ + K + I+ KK E+++ Sbjct: 144 QFSSTVTCCECGHSSVVYEPFLDLSLPIPSKQSLGKISEPMGVPILPKEEICAKKLETDA 203 Query: 372 KEI 364 ++ Sbjct: 204 PKL 206