BLASTX nr result
ID: Ephedra25_contig00018325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00018325 (684 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [A... 67 7e-09 >ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda] gi|548856685|gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda] Length = 439 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 128 MPSVVQDSVPSAPGKVKIERSNYHFNRQLNRWLMSPATLFFW 3 MPS +QDS PS PGKVKI+RS+Y+ +RQ+NRWL S ATL FW Sbjct: 1 MPSSLQDSFPSTPGKVKIDRSHYNLSRQINRWLSSSATLVFW 42