BLASTX nr result
ID: Ephedra25_contig00017479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00017479 (522 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC32108.1| acyl-CoA oxidase homolog [Picea mariana] 59 9e-07 ref|XP_001786103.1| predicted protein [Physcomitrella patens] gi... 57 2e-06 ref|XP_002979998.1| hypothetical protein SELMODRAFT_178082 [Sela... 56 6e-06 ref|XP_002991925.1| hypothetical protein SELMODRAFT_134372 [Sela... 56 6e-06 ref|XP_001754596.1| predicted protein [Physcomitrella patens] gi... 56 6e-06 >gb|AAC32108.1| acyl-CoA oxidase homolog [Picea mariana] Length = 223 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 418 LGFLQHRTSVLLHTAALRLRKHSKTLGSFHAWNRC 522 L ++RTS LLHTAALRLRKHSK+LGSF AWNRC Sbjct: 71 LDAFRYRTSRLLHTAALRLRKHSKSLGSFEAWNRC 105 >ref|XP_001786103.1| predicted protein [Physcomitrella patens] gi|162662133|gb|EDQ49085.1| predicted protein [Physcomitrella patens] Length = 691 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 418 LGFLQHRTSVLLHTAALRLRKHSKTLGSFHAWNRC 522 L Q+RT+ LLHTAALRLRKHSK LGSF AWNRC Sbjct: 538 LDAFQYRTARLLHTAALRLRKHSKRLGSFGAWNRC 572 >ref|XP_002979998.1| hypothetical protein SELMODRAFT_178082 [Selaginella moellendorffii] gi|300152225|gb|EFJ18868.1| hypothetical protein SELMODRAFT_178082 [Selaginella moellendorffii] Length = 694 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 418 LGFLQHRTSVLLHTAALRLRKHSKTLGSFHAWNRC 522 L Q+RT+ LLHTAALRLRKHS+ LGSF AWNRC Sbjct: 542 LDAFQYRTARLLHTAALRLRKHSQRLGSFGAWNRC 576 >ref|XP_002991925.1| hypothetical protein SELMODRAFT_134372 [Selaginella moellendorffii] gi|300140311|gb|EFJ07036.1| hypothetical protein SELMODRAFT_134372 [Selaginella moellendorffii] Length = 694 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 418 LGFLQHRTSVLLHTAALRLRKHSKTLGSFHAWNRC 522 L Q+RT+ LLHTAALRLRKHS+ LGSF AWNRC Sbjct: 542 LDAFQYRTARLLHTAALRLRKHSQRLGSFGAWNRC 576 >ref|XP_001754596.1| predicted protein [Physcomitrella patens] gi|162694217|gb|EDQ80566.1| predicted protein [Physcomitrella patens] Length = 682 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +1 Query: 418 LGFLQHRTSVLLHTAALRLRKHSKTLGSFHAWNRC 522 L Q+RT+ LLHTAALRLRKHSK GSF AWNRC Sbjct: 529 LDAFQYRTARLLHTAALRLRKHSKRFGSFGAWNRC 563