BLASTX nr result
ID: Ephedra25_contig00016354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00016354 (468 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356836.1| PREDICTED: AP2-like ethylene-responsive tran... 55 7e-06 ref|XP_004238066.1| PREDICTED: AP2-like ethylene-responsive tran... 55 1e-05 >ref|XP_006356836.1| PREDICTED: AP2-like ethylene-responsive transcription factor ANT-like isoform X1 [Solanum tuberosum] gi|565380917|ref|XP_006356837.1| PREDICTED: AP2-like ethylene-responsive transcription factor ANT-like isoform X2 [Solanum tuberosum] Length = 655 Score = 55.5 bits (132), Expect = 7e-06 Identities = 35/103 (33%), Positives = 49/103 (47%), Gaps = 28/103 (27%) Frame = +2 Query: 188 KYKYMLPESVEEDNNMNN-------WLGFSLDPS---------------------HLPST 283 K K M +S +NN +N WLGFSL P +L S+ Sbjct: 2 KMKAMNDDSRSNNNNNHNSAAANSNWLGFSLSPHMKMEVTNSSETQHQHQFAQSFYLSSS 61 Query: 284 SPQPLQLQENANECYSHYPSAAHVTELPLRSDGSLCIMEALRR 412 P P+ + + CY + P + ++ +PL+SDGSLCIMEAL R Sbjct: 62 PPPPMNVSTTSALCYENNPFHSSLSVMPLKSDGSLCIMEALSR 104 >ref|XP_004238066.1| PREDICTED: AP2-like ethylene-responsive transcription factor ANT-like [Solanum lycopersicum] Length = 654 Score = 55.1 bits (131), Expect = 1e-05 Identities = 35/105 (33%), Positives = 50/105 (47%), Gaps = 30/105 (28%) Frame = +2 Query: 188 KYKYMLPESVEEDNNMNN---------WLGFSLDPS---------------------HLP 277 K K M +S +NN++N WLGFSL P +L Sbjct: 2 KMKSMNDDSRSSNNNISNNNSAAANTNWLGFSLTPHMKMEVTNSSDTQHQHQFAQSFYLS 61 Query: 278 STSPQPLQLQENANECYSHYPSAAHVTELPLRSDGSLCIMEALRR 412 S+ P P+ + + CY + P + ++ +PL+SDGSLCIMEAL R Sbjct: 62 SSPPPPMNVSTTSALCYENNPFHSTLSVMPLKSDGSLCIMEALSR 106