BLASTX nr result
ID: Ephedra25_contig00016352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00016352 (416 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006855453.1| hypothetical protein AMTR_s00057p00175710 [A... 59 7e-07 >ref|XP_006855453.1| hypothetical protein AMTR_s00057p00175710 [Amborella trichopoda] gi|548859219|gb|ERN16920.1| hypothetical protein AMTR_s00057p00175710 [Amborella trichopoda] Length = 480 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 3/74 (4%) Frame = -2 Query: 292 QKRKLEQNS---VDQQKRKIQRNDKFGSFFGPSQQVIAKRAIENTQSRLAAAHMARKDPS 122 Q+ K E N+ + Q+ ++ D FGSFFGPSQ VIA+R IE T+++L A HMA K P Sbjct: 71 QQMKKETNAAVGLSQEMKRTLPKDNFGSFFGPSQPVIARRVIEETRAKLEAEHMAAKLPK 130 Query: 121 NKLEKSRTPTSNQS 80 E + +S S Sbjct: 131 ASSENKKALSSTTS 144