BLASTX nr result
ID: Ephedra25_contig00016225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00016225 (402 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK25048.1| unknown [Picea sitchensis] 62 8e-08 gb|AFG67414.1| hypothetical protein CL4360Contig1_02, partial [P... 57 2e-06 gb|AEW09155.1| hypothetical protein CL4360Contig1_02, partial [P... 57 2e-06 gb|AFG67415.1| hypothetical protein CL4360Contig1_02, partial [P... 56 6e-06 >gb|ABK25048.1| unknown [Picea sitchensis] Length = 510 Score = 62.0 bits (149), Expect = 8e-08 Identities = 35/84 (41%), Positives = 50/84 (59%) Frame = -3 Query: 325 PQSEEEAPCLRRFSVELAKGVLEKMKGTESVLGCGRRERLRSWLKEILATTSEMERYVTF 146 P+ +E +RRFS+EL V+EK + R L + L+ ++ TTSEME Y TF Sbjct: 429 PRPSKEVASIRRFSIELLIAVMEK----DDKAALEERTDLVNALEGVMETTSEMESYSTF 484 Query: 145 SGSVGVTPHSLSMHDLVLSAIHTL 74 SGSVG++ H + +H LV SA+ L Sbjct: 485 SGSVGLSRHRIPIHSLVQSAMELL 508 >gb|AFG67414.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] Length = 83 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/77 (38%), Positives = 46/77 (59%) Frame = -3 Query: 325 PQSEEEAPCLRRFSVELAKGVLEKMKGTESVLGCGRRERLRSWLKEILATTSEMERYVTF 146 P+ E P +RRFS+EL V++ + ++ R L L+ ++ TTSEME Y TF Sbjct: 11 PRPSREVPSIRRFSIELLFAVMKMDRSAIEMM----RSELEEALEAVMETTSEMESYSTF 66 Query: 145 SGSVGVTPHSLSMHDLV 95 SGSVG++ H +++ LV Sbjct: 67 SGSVGLSRHRVTISSLV 83 >gb|AEW09155.1| hypothetical protein CL4360Contig1_02, partial [Pinus radiata] gi|383168640|gb|AFG67416.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168642|gb|AFG67417.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168644|gb|AFG67418.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168646|gb|AFG67419.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168648|gb|AFG67420.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168650|gb|AFG67421.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168652|gb|AFG67422.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168654|gb|AFG67423.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168656|gb|AFG67424.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168658|gb|AFG67425.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] gi|383168660|gb|AFG67426.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] Length = 83 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/77 (38%), Positives = 46/77 (59%) Frame = -3 Query: 325 PQSEEEAPCLRRFSVELAKGVLEKMKGTESVLGCGRRERLRSWLKEILATTSEMERYVTF 146 P+ E P +RRFS+EL V++ + ++ R L L+ ++ TTSEME Y TF Sbjct: 11 PRPSREVPSIRRFSIELLIAVMKMDRSAIEMM----RSELEEALEAVMETTSEMESYSTF 66 Query: 145 SGSVGVTPHSLSMHDLV 95 SGSVG++ H +++ LV Sbjct: 67 SGSVGLSRHRVTISSLV 83 >gb|AFG67415.1| hypothetical protein CL4360Contig1_02, partial [Pinus taeda] Length = 83 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/77 (38%), Positives = 45/77 (58%) Frame = -3 Query: 325 PQSEEEAPCLRRFSVELAKGVLEKMKGTESVLGCGRRERLRSWLKEILATTSEMERYVTF 146 P+ E P +RRFS+EL V + + ++ R L L+ ++ TTSEME Y TF Sbjct: 11 PRPSREVPSIRRFSIELLIAVTKIDRSAIEMM----RSELEETLEAVMETTSEMESYSTF 66 Query: 145 SGSVGVTPHSLSMHDLV 95 SGSVG++ H +++ LV Sbjct: 67 SGSVGLSRHRVTISSLV 83