BLASTX nr result
ID: Ephedra25_contig00014808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00014808 (559 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854546.1| hypothetical protein AMTR_s00030p00056570 [A... 56 7e-06 >ref|XP_006854546.1| hypothetical protein AMTR_s00030p00056570 [Amborella trichopoda] gi|548858232|gb|ERN16013.1| hypothetical protein AMTR_s00030p00056570 [Amborella trichopoda] Length = 1109 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = +1 Query: 16 SDLLQLELKRTQMNFICFRETCIQLDSVSDM-GRNSYQPSNGIKPLPNNQVKTNQPVGSA 192 SDLL++EL+RT +N CF E+ + L+SV + +Y P G P+ + +QPVGS Sbjct: 1042 SDLLEVELERTHINISCFMESSLPLESVPQQPPQPTYPPYRGSLDSPSRNYRGSQPVGSP 1101 Query: 193 SFSHHRRK 216 FS HR + Sbjct: 1102 GFSRHRHR 1109