BLASTX nr result
ID: Ephedra25_contig00014663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00014663 (473 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008937858.1| protein of unknown function [Magnetospirillu... 49 1e-09 ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 49 2e-06 >ref|YP_008937858.1| protein of unknown function [Magnetospirillum gryphiswaldense MSR-1 v2] gi|568205844|ref|WP_024080208.1| hypothetical protein [Magnetospirillum gryphiswaldense] gi|78033430|emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense MSR-1] gi|566555979|emb|CDK99198.1| protein of unknown function [Magnetospirillum gryphiswaldense MSR-1 v2] Length = 259 Score = 49.3 bits (116), Expect(2) = 1e-09 Identities = 23/40 (57%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -3 Query: 300 LAFHP*PQVIPVFCHIRGFGPTMQL-DGSTCSWLDRSVSG 184 +AFHP PQ+IP F + RGFGP + + STC W+D SVSG Sbjct: 1 MAFHPYPQIIPDFFNRRGFGPPVGVTPPSTCPWIDHSVSG 40 Score = 38.9 bits (89), Expect(2) = 1e-09 Identities = 20/42 (47%), Positives = 24/42 (57%) Frame = -2 Query: 127 SLTHYAKGTPFHLRKKGYDWMARIGFEGSVALPYHGFFSPFP 2 SLTHY KGTP ++ R G+V+LP G FSPFP Sbjct: 69 SLTHYTKGTPSPFKRA--PTACRHSVSGTVSLPLSGCFSPFP 108 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 48.9 bits (115), Expect(2) = 2e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -2 Query: 301 VGLSPLATSHPRILPHTWVRSYHA 230 VGLSPLATSHPRILPHTWVRS A Sbjct: 844 VGLSPLATSHPRILPHTWVRSSKA 867 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 353 VRSTAIDFAVNQLSPIL 303 +RST IDFA NQL PIL Sbjct: 827 IRSTEIDFAENQLYPIL 843