BLASTX nr result
ID: Ephedra25_contig00014075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00014075 (758 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529841.1| calcium ion binding protein, putative [Ricin... 54 2e-11 gb|ABR18438.1| unknown [Picea sitchensis] 64 4e-08 ref|XP_003536224.1| PREDICTED: probable serine/threonine protein... 63 1e-07 gb|ESW16021.1| hypothetical protein PHAVU_007G123000g [Phaseolus... 62 3e-07 ref|XP_003556377.1| PREDICTED: probable serine/threonine protein... 62 3e-07 ref|XP_002528837.1| calcium ion binding protein, putative [Ricin... 62 3e-07 ref|XP_006361409.1| PREDICTED: probable serine/threonine protein... 61 4e-07 ref|XP_004236780.1| PREDICTED: serine/threonine-protein phosphat... 61 4e-07 ref|XP_003590841.1| Serine/threonine protein phosphatase 2A regu... 61 5e-07 emb|CDK13062.1| putative predicted protein [Malus domestica] 60 6e-07 gb|ESW19214.1| hypothetical protein PHAVU_006G105800g [Phaseolus... 60 6e-07 gb|ESW16006.1| hypothetical protein PHAVU_007G121700g [Phaseolus... 60 6e-07 gb|ESW16005.1| hypothetical protein PHAVU_007G121700g [Phaseolus... 60 6e-07 gb|EOY10902.1| Calcium-binding EF-hand family protein isoform 5 ... 60 6e-07 gb|EOY10901.1| Calcium-binding EF-hand family protein isoform 4 ... 60 6e-07 gb|EOY10900.1| Calcium-binding EF-hand family protein isoform 3 ... 60 6e-07 gb|EOY10899.1| Calcium-binding EF-hand family protein isoform 2,... 60 6e-07 gb|EOY10898.1| Calcium-binding EF-hand family protein isoform 1 ... 60 6e-07 ref|XP_004494751.1| PREDICTED: serine/threonine-protein phosphat... 60 6e-07 ref|XP_004302093.1| PREDICTED: serine/threonine-protein phosphat... 60 6e-07 >ref|XP_002529841.1| calcium ion binding protein, putative [Ricinus communis] gi|223530669|gb|EEF32542.1| calcium ion binding protein, putative [Ricinus communis] Length = 545 Score = 54.3 bits (129), Expect(2) = 2e-11 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +2 Query: 671 DFKPVLRELLNTHPGLEFLQSTLEFQERY 757 DFKP LRELL THPGLEFLQ+T EFQERY Sbjct: 243 DFKPFLRELLATHPGLEFLQTTPEFQERY 271 Score = 41.6 bits (96), Expect(2) = 2e-11 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +3 Query: 411 TGTALGDQLVSYWIDKKMVTMDLASQIFTVLRQLEKSSLTQLCYNLF 551 +G D+ + YW+D M+ MD+ + IF VL+Q E + LTQ + F Sbjct: 201 SGVVTRDKFIKYWVDGNMLAMDITTCIFHVLKQPENNYLTQADFKPF 247 >gb|ABR18438.1| unknown [Picea sitchensis] Length = 546 Score = 64.3 bits (155), Expect = 4e-08 Identities = 34/56 (60%), Positives = 39/56 (69%) Frame = +3 Query: 366 F*QLVLFTKVPGTRNTGTALGDQLVSYWIDKKMVTMDLASQIFTVLRQLEKSSLTQ 533 F LF K+ NTG DQ VSYWID+KMVTMD A+QIFTVLRQ +K+ LTQ Sbjct: 188 FFSTTLFKKID-VDNTGVVTRDQFVSYWIDEKMVTMDSANQIFTVLRQTDKNYLTQ 242 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKP+LRELL THPGLEFL ST EFQERY Sbjct: 242 QDDFKPILRELLATHPGLEFLHSTQEFQERY 272 >ref|XP_003536224.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma-like [Glycine max] Length = 541 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 662 IEDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 ++DDFKPVLRELL+THPGLEFLQST EFQERY Sbjct: 236 VQDDFKPVLRELLSTHPGLEFLQSTPEFQERY 267 >gb|ESW16021.1| hypothetical protein PHAVU_007G123000g [Phaseolus vulgaris] Length = 215 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL+THPGLEFLQST EFQERY Sbjct: 45 QDDFKPVLRELLSTHPGLEFLQSTPEFQERY 75 >ref|XP_003556377.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma-like isoform X1 [Glycine max] gi|571569374|ref|XP_006606383.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma-like isoform X2 [Glycine max] Length = 540 Score = 61.6 bits (148), Expect = 3e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +2 Query: 662 IEDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 ++DDFKPVLRELL+THPGLEFLQ+T EFQERY Sbjct: 235 VQDDFKPVLRELLSTHPGLEFLQTTPEFQERY 266 >ref|XP_002528837.1| calcium ion binding protein, putative [Ricinus communis] gi|223531749|gb|EEF33571.1| calcium ion binding protein, putative [Ricinus communis] Length = 544 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/56 (55%), Positives = 42/56 (75%) Frame = +2 Query: 590 NIVNLII*TFKYT*MLFFVCEIIQIEDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 N++ + + T YT + CE + +DDFKP+LR+LL +HPGLEFLQST+EFQERY Sbjct: 216 NLLTMDLATRIYTVLKQRDCEYLT-QDDFKPILRDLLASHPGLEFLQSTIEFQERY 270 >ref|XP_006361409.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma-like [Solanum tuberosum] Length = 539 Score = 61.2 bits (147), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 662 IEDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 ++DDFKP+LRELL THPGLEFLQST EFQERY Sbjct: 234 VQDDFKPILRELLATHPGLEFLQSTPEFQERY 265 >ref|XP_004236780.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like [Solanum lycopersicum] Length = 539 Score = 61.2 bits (147), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 662 IEDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 ++DDFKP+LRELL THPGLEFLQST EFQERY Sbjct: 234 VQDDFKPILRELLATHPGLEFLQSTPEFQERY 265 >ref|XP_003590841.1| Serine/threonine protein phosphatase 2A regulatory subunit B' subunit alpha [Medicago truncatula] gi|355479889|gb|AES61092.1| Serine/threonine protein phosphatase 2A regulatory subunit B' subunit alpha [Medicago truncatula] Length = 557 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 662 IEDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 ++DDFKP+LRELL++HPGLEFLQST EFQERY Sbjct: 252 VQDDFKPILRELLSSHPGLEFLQSTPEFQERY 283 >emb|CDK13062.1| putative predicted protein [Malus domestica] Length = 539 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 235 QDDFKPVLRELLATHPGLEFLQSTHEFQERY 265 >gb|ESW19214.1| hypothetical protein PHAVU_006G105800g [Phaseolus vulgaris] Length = 537 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 233 QDDFKPVLRELLATHPGLEFLQSTPEFQERY 263 >gb|ESW16006.1| hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris] gi|561017203|gb|ESW16007.1| hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris] Length = 535 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 231 QDDFKPVLRELLATHPGLEFLQSTPEFQERY 261 >gb|ESW16005.1| hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris] Length = 379 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 75 QDDFKPVLRELLATHPGLEFLQSTPEFQERY 105 >gb|EOY10902.1| Calcium-binding EF-hand family protein isoform 5 [Theobroma cacao] Length = 402 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 235 QDDFKPVLRELLATHPGLEFLQSTPEFQERY 265 >gb|EOY10901.1| Calcium-binding EF-hand family protein isoform 4 [Theobroma cacao] Length = 421 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 235 QDDFKPVLRELLATHPGLEFLQSTPEFQERY 265 >gb|EOY10900.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao] Length = 398 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 235 QDDFKPVLRELLATHPGLEFLQSTPEFQERY 265 >gb|EOY10899.1| Calcium-binding EF-hand family protein isoform 2, partial [Theobroma cacao] Length = 485 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 235 QDDFKPVLRELLATHPGLEFLQSTPEFQERY 265 >gb|EOY10898.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao] Length = 539 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 235 QDDFKPVLRELLATHPGLEFLQSTPEFQERY 265 >ref|XP_004494751.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like [Cicer arietinum] Length = 537 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 233 QDDFKPVLRELLATHPGLEFLQSTPEFQERY 263 >ref|XP_004302093.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like [Fragaria vesca subsp. vesca] Length = 540 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 665 EDDFKPVLRELLNTHPGLEFLQSTLEFQERY 757 +DDFKPVLRELL THPGLEFLQST EFQERY Sbjct: 236 QDDFKPVLRELLATHPGLEFLQSTPEFQERY 266