BLASTX nr result
ID: Ephedra25_contig00013324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00013324 (1051 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001755573.1| predicted protein [Physcomitrella patens] gi... 46 4e-09 ref|XP_002983762.1| hypothetical protein SELMODRAFT_422943 [Sela... 46 4e-09 ref|XP_002990493.1| hypothetical protein SELMODRAFT_428953 [Sela... 46 4e-09 >ref|XP_001755573.1| predicted protein [Physcomitrella patens] gi|162693280|gb|EDQ79633.1| predicted protein [Physcomitrella patens] Length = 544 Score = 46.2 bits (108), Expect(2) = 4e-09 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = +3 Query: 153 SQTSSVEYFIRRFQAKELVTEMEVEYSFSNW 245 S++ SVEYF RRF+A+++V+EMEVEY SNW Sbjct: 396 SESLSVEYFARRFRAQDIVSEMEVEYWSSNW 426 Score = 42.4 bits (98), Expect(2) = 4e-09 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +2 Query: 245 VDYICTLYDQRVGVSVTRAMCHP 313 VDYICTLY QRVGVSV+RAM P Sbjct: 429 VDYICTLYGQRVGVSVSRAMAFP 451 >ref|XP_002983762.1| hypothetical protein SELMODRAFT_422943 [Selaginella moellendorffii] gi|300148599|gb|EFJ15258.1| hypothetical protein SELMODRAFT_422943 [Selaginella moellendorffii] Length = 343 Score = 45.8 bits (107), Expect(2) = 4e-09 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = +3 Query: 141 DNYKSQTSSVEYFIRRFQAKELVTEMEVEYSFSNW 245 D+ Q+ SVEYF+R+F+A ++VTEMEVEY NW Sbjct: 200 DSSCMQSLSVEYFVRKFKATDVVTEMEVEYCAMNW 234 Score = 42.7 bits (99), Expect(2) = 4e-09 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +2 Query: 245 VDYICTLYDQRVGVSVTRAMCHP 313 VDYIC LY QRVGVSVTRAM +P Sbjct: 237 VDYICNLYGQRVGVSVTRAMSYP 259 >ref|XP_002990493.1| hypothetical protein SELMODRAFT_428953 [Selaginella moellendorffii] gi|300141661|gb|EFJ08370.1| hypothetical protein SELMODRAFT_428953 [Selaginella moellendorffii] Length = 272 Score = 45.8 bits (107), Expect(2) = 4e-09 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = +3 Query: 141 DNYKSQTSSVEYFIRRFQAKELVTEMEVEYSFSNW 245 D+ Q+ SVEYF+R+F+A ++VTEMEVEY NW Sbjct: 120 DSSCMQSLSVEYFVRKFKATDVVTEMEVEYCAMNW 154 Score = 42.7 bits (99), Expect(2) = 4e-09 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +2 Query: 245 VDYICTLYDQRVGVSVTRAMCHP 313 VDYIC LY QRVGVSVTRAM +P Sbjct: 157 VDYICNLYGQRVGVSVTRAMSYP 179