BLASTX nr result
ID: Ephedra25_contig00013298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00013298 (826 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843727.1| hypothetical protein AMTR_s00007p00221730 [A... 59 3e-06 ref|XP_003557997.1| PREDICTED: nucleoside-triphosphatase-like [B... 59 3e-06 >ref|XP_006843727.1| hypothetical protein AMTR_s00007p00221730 [Amborella trichopoda] gi|548846095|gb|ERN05402.1| hypothetical protein AMTR_s00007p00221730 [Amborella trichopoda] Length = 473 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 645 MRKVRHESLAEKMHRYRGVIFVIGVPVLLISFVLIFMPRAP 767 M+++RHES E+++R+RGVI VI VP+LLISFVL MPR P Sbjct: 1 MKRMRHESTGERLYRFRGVILVICVPLLLISFVLFLMPRVP 41 >ref|XP_003557997.1| PREDICTED: nucleoside-triphosphatase-like [Brachypodium distachyon] Length = 484 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/51 (52%), Positives = 38/51 (74%) Frame = +3 Query: 648 RKVRHESLAEKMHRYRGVIFVIGVPVLLISFVLIFMPRAPVDDTANAGVGL 800 R+ + E++++++HRYRGV+ V+ PVLLISFVL+ MPR P TA A GL Sbjct: 10 RQQQGEAVSDRVHRYRGVLMVVLAPVLLISFVLLLMPRPPPSVTARASTGL 60