BLASTX nr result
ID: Ephedra25_contig00013157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00013157 (600 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869260.1| nucleic acid binding protein [Arabidopsis ly... 57 5e-06 ref|NP_001154281.1| Enhancer of polycomb-like transcription fact... 56 8e-06 ref|NP_194988.2| Enhancer of polycomb-like transcription factor ... 56 8e-06 emb|CAA18599.1| putative protein [Arabidopsis thaliana] gi|72701... 56 8e-06 >ref|XP_002869260.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] gi|297315096|gb|EFH45519.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] Length = 1550 Score = 56.6 bits (135), Expect = 5e-06 Identities = 21/46 (45%), Positives = 30/46 (65%) Frame = +3 Query: 456 RDERMFKDYAYKDADSHHVVGKRVKIFWPLDDAWYEGVVHSFDSKK 593 R R F + + D DSH ++ K++K+FWPLD++WY G V FD K Sbjct: 338 RKRRHFYEILFSDVDSHWLLNKKIKVFWPLDESWYHGFVDGFDGDK 383 >ref|NP_001154281.1| Enhancer of polycomb-like transcription factor protein [Arabidopsis thaliana] gi|332660691|gb|AEE86091.1| Enhancer of polycomb-like transcription factor protein [Arabidopsis thaliana] Length = 1540 Score = 55.8 bits (133), Expect = 8e-06 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = +3 Query: 456 RDERMFKDYAYKDADSHHVVGKRVKIFWPLDDAWYEGVVHSFDSKK 593 R R F + + D DSH ++ K++K+FWPLD+ WY G V FD K Sbjct: 337 RKRRHFYEILFSDVDSHWLLNKKIKVFWPLDERWYHGFVDGFDGDK 382 >ref|NP_194988.2| Enhancer of polycomb-like transcription factor protein [Arabidopsis thaliana] gi|332660690|gb|AEE86090.1| Enhancer of polycomb-like transcription factor protein [Arabidopsis thaliana] Length = 1539 Score = 55.8 bits (133), Expect = 8e-06 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = +3 Query: 456 RDERMFKDYAYKDADSHHVVGKRVKIFWPLDDAWYEGVVHSFDSKK 593 R R F + + D DSH ++ K++K+FWPLD+ WY G V FD K Sbjct: 337 RKRRHFYEILFSDVDSHWLLNKKIKVFWPLDERWYHGFVDGFDGDK 382 >emb|CAA18599.1| putative protein [Arabidopsis thaliana] gi|7270166|emb|CAB79979.1| putative protein [Arabidopsis thaliana] Length = 1544 Score = 55.8 bits (133), Expect = 8e-06 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = +3 Query: 456 RDERMFKDYAYKDADSHHVVGKRVKIFWPLDDAWYEGVVHSFDSKK 593 R R F + + D DSH ++ K++K+FWPLD+ WY G V FD K Sbjct: 342 RKRRHFYEILFSDVDSHWLLNKKIKVFWPLDERWYHGFVDGFDGDK 387