BLASTX nr result
ID: Ephedra25_contig00011240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00011240 (501 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006595675.1| PREDICTED: uncharacterized protein LOC100788... 56 4e-06 ref|XP_004303557.1| PREDICTED: uncharacterized protein LOC101304... 56 4e-06 gb|ESW14478.1| hypothetical protein PHAVU_008G284400g [Phaseolus... 55 1e-05 gb|EMJ18204.1| hypothetical protein PRUPE_ppa002219mg [Prunus pe... 55 1e-05 ref|XP_003617938.1| Curved DNA-binding protein [Medicago truncat... 55 1e-05 >ref|XP_006595675.1| PREDICTED: uncharacterized protein LOC100788692 [Glycine max] Length = 707 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/58 (39%), Positives = 36/58 (62%) Frame = -3 Query: 478 SECPGLSTSDYTMETFWTACEHCHTQYNLSQRYKNEMVLCKSCKSQFLAVEAISIPAD 305 ++C LST ++TFWT C C QY ++Y N+ + CK+C+ F+AVE + PA+ Sbjct: 154 NKCSNLSTPCGGLDTFWTICTSCKVQYEYLRKYVNKRLSCKNCRGTFVAVETGAAPAN 211 >ref|XP_004303557.1| PREDICTED: uncharacterized protein LOC101304489 [Fragaria vesca subsp. vesca] Length = 774 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/54 (40%), Positives = 36/54 (66%) Frame = -3 Query: 466 GLSTSDYTMETFWTACEHCHTQYNLSQRYKNEMVLCKSCKSQFLAVEAISIPAD 305 G++TS ++TFWT C C QY ++Y N+ + CK+C+ F+AVE+ + PA+ Sbjct: 150 GVTTSHGRLDTFWTVCTSCKVQYEYLRKYVNKRLSCKNCRGVFIAVESGAAPAN 203 >gb|ESW14478.1| hypothetical protein PHAVU_008G284400g [Phaseolus vulgaris] Length = 698 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/58 (37%), Positives = 36/58 (62%) Frame = -3 Query: 478 SECPGLSTSDYTMETFWTACEHCHTQYNLSQRYKNEMVLCKSCKSQFLAVEAISIPAD 305 ++C LS+ ++TFWT C C QY ++Y N+ + CK+C+ F+AVE + PA+ Sbjct: 152 NKCSNLSSPRGGLDTFWTICTSCKVQYEYLRKYVNKKLSCKNCRGTFVAVETGAAPAN 209 >gb|EMJ18204.1| hypothetical protein PRUPE_ppa002219mg [Prunus persica] Length = 699 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/58 (37%), Positives = 35/58 (60%) Frame = -3 Query: 478 SECPGLSTSDYTMETFWTACEHCHTQYNLSQRYKNEMVLCKSCKSQFLAVEAISIPAD 305 + C S S ++TFWT C C QY ++Y N+ + CK+C+ F+AVE+ + PA+ Sbjct: 155 NNCSNSSASHGRLDTFWTVCTSCKVQYEYLRKYVNKRLSCKNCRGIFIAVESGAAPAN 212 >ref|XP_003617938.1| Curved DNA-binding protein [Medicago truncatula] gi|355519273|gb|AET00897.1| Curved DNA-binding protein [Medicago truncatula] Length = 692 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/58 (37%), Positives = 35/58 (60%) Frame = -3 Query: 478 SECPGLSTSDYTMETFWTACEHCHTQYNLSQRYKNEMVLCKSCKSQFLAVEAISIPAD 305 ++C L S ++TFWT C C QY ++Y N+ + CK+C+ F+AVE + PA+ Sbjct: 140 NKCSNLPASRSKLDTFWTICTACKVQYEYLRKYVNKKLSCKNCRGTFVAVETGAAPAN 197