BLASTX nr result
ID: Ephedra25_contig00010595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00010595 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006436855.1| hypothetical protein CICLE_v10032864mg [Citr... 45 2e-07 >ref|XP_006436855.1| hypothetical protein CICLE_v10032864mg [Citrus clementina] gi|568880628|ref|XP_006493212.1| PREDICTED: mediator of RNA polymerase II transcription subunit 30-like [Citrus sinensis] gi|557539051|gb|ESR50095.1| hypothetical protein CICLE_v10032864mg [Citrus clementina] Length = 183 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Frame = +3 Query: 273 HDMSSNGGGG--ALEESRLRYKATVTSLRAVISAIAPSLQNQSHDDAEMDVDARPDQDEI 446 H + S+GG G AL+E+R RYK +V +LRAV++AI S + +S + VD+ DE+ Sbjct: 78 HHLDSSGGSGNSALDEARHRYKTSVAALRAVLTAIPNSHKAKSFEMVSSPVDSVSRSDEV 137 Score = 35.4 bits (80), Expect(2) = 2e-07 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +2 Query: 134 QELAMEGQKHLESTVEAAHQ 193 QELA EGQKHLE T+EAA Q Sbjct: 18 QELAKEGQKHLEETIEAAFQ 37