BLASTX nr result
ID: Ephedra25_contig00010555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra25_contig00010555 (437 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK25572.1| unknown [Picea sitchensis] 64 2e-08 >gb|ABK25572.1| unknown [Picea sitchensis] Length = 220 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 3/55 (5%) Frame = -3 Query: 381 DQGEGQPSWALADFF-NEAPSRSSSVG--HQRHHSIGSKVPTLLSGICGRTSIEA 226 DQ + PSWA A++F ++A SR SSV H R+HS+GS+VPT SGICGRTSIEA Sbjct: 166 DQADIHPSWAPAEWFTSDANSRRSSVRAHHHRNHSLGSRVPTFFSGICGRTSIEA 220